Property Summary

NCBI Gene PubMed Count 18
PubMed Score 18.73
PubTator Score 16.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma 1.405 7.2e-03
adult high grade glioma 1.600 4.5e-05
Atopic dermatitis 1.400 1.5e-03
atypical teratoid / rhabdoid tumor 2.400 5.8e-09
Breast cancer 1.300 1.3e-06
breast carcinoma 1.100 7.1e-04
Endometriosis 1.186 3.7e-02
glioblastoma 2.000 1.2e-07
group 3 medulloblastoma 2.500 2.6e-05
intraductal papillary-mucinous carcinoma... 1.700 2.3e-04
intraductal papillary-mucinous neoplasm ... 1.900 3.1e-04
invasive ductal carcinoma 1.300 2.8e-03
lung adenocarcinoma 2.000 1.3e-07
medulloblastoma, large-cell 3.000 4.8e-07
nasopharyngeal carcinoma 1.200 1.4e-04
non-small cell lung cancer 1.848 1.5e-22
osteosarcoma 1.514 2.0e-02
ovarian cancer 1.900 1.8e-07
posterior fossa group A ependymoma 1.300 2.2e-06
primitive neuroectodermal tumor 2.500 1.1e-04
psoriasis 1.300 8.7e-13
ulcerative colitis 1.200 4.3e-04

Gene RIF (12)

AA Sequence

MDANSKDKPPETKESAMNNAGNASFILGTGKIVTPQKHAELPPNPCTPDTFKSPLNFSTVTVEQLGITPE      1 - 70
SFVRNSAGKSSSYLKKCRRRSAVGARGSPETNHLIRFIARQQNIKNARKSPLAQDSPSQGSPALYRNVNT     71 - 140
LRERISAFQSAFHSIKENEKMTGCLEFSEAGKESEMTDLTRKEGLSACQQSGFPAVLSSKRRRISYQRDS    141 - 210
DENLTDAEGKVIGLQIFNIDTDRACAVETSVDLSEISSKLGSTQSGFLVEESLPLSELTETSNALKVADC    211 - 280
VVGKGSSDAVSPDTFTAEVSSDAVPDVRSPATPACRRDLPTPKTFVLRSVLKKPSVKMCLESLQEHCNNL    281 - 350
YDDDGTHPSLISNLPNCCKEKEAEDEENFEAPAFLNMRKRKRVTFGEDLSPEVFDESLPANTPLRKGGTP    351 - 420
VCKKDFSGLSSLLLEQSPVPEPLPQPDFDDKGENLENIEPLQVSFAVLSSPNKSSISETLSGTDTFSSSN    421 - 490
NHEKISSPKVGRITRTSNRRNQLVSVVEESVCNLLNTEVQPCKEKKINRRKSQETKCTKRALPKKSQVLK    491 - 560
SCRKKKGKGKKSVQKSLYGERDIASKKPLLSPIPELPEVPEMTPSIPSIRRLGSGYFSSNGKLEEVKTPK    561 - 630
NPVKRKDLLRHDPDLHMHQGYDKYDVSEFCSYIKSSSSLGNATSDEDPNTNIMNINENKNIPKAKNKSES    631 - 700
ENEPKAGTDSPVSCASVTEERVASDSPKPALTLQQGQEFSAGGQNAENLCQFFKISPDLNIKCERKDDFL    701 - 770
GAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGR    771 - 840
SLHLEKNGNHTPSSSVGSSVEISLENSELFKDLSDAIEQTFQRRNSETKVRRSTRLQKDLENEGLVWISL    841 - 910
PLPSTSQKAKRRTICTFDSSGFESMSPIKETVSSRQKPQMAPPVSDPENSQGPAAGSSDEPGKRRKSFCI    911 - 980
STLANTKATSQFKGYRRRSSLNGKGESSLTALERIEHNGERKQ                               981 - 1023
//

Text Mined References (29)

PMID Year Title