Property Summary

NCBI Gene PubMed Count 15
Grant Count 4
Funding $36,987.6
PubMed Score 16.18
PubTator Score 16.87

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q69YH5 Q3SX74 Q4G0W0 Q5RKN0 Q69YI4 Q6P464 Q8N7C1
Symbols PPP1R81
Repo-Man

Gene

Gene RIF (9)

PMID Text
23746640 Aurora B phosphorylates Repo-Man at S893, preventing its recruitment by histones.
23418564 Data indicate that CDCA2 frequently is overexpressed in oral squamous cell carcinoma (OSCC) and might be associated with OSCC progression by preventing cell-cycle arrest and apoptosis.
23362328 Proteomic identification of a large number of novel RepoMan interactors.
22801782 It was shown that Repo-Man and Sds22 contribute to timely Aurora B kinase substrate dephosphorylation on anaphase chromatin.
21820363 This study demonistrated that identify Repo-Man as a key factor that coordinates chromatin remodeling and early events of nuclear envelope reformation during mitotic exit.
21514157 Repo-Man promotes H3T11ph dephosphorylation by an indirect mechanism but directly and specifically targets H3T3ph for dephosphorylation by associated PP1gamma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20188555 This study reports essential DNA damage response regulation mediated by Repo-Man-protein phosphatase 1 and further delineate underlying mechanisms.
16492807 Repo-Man forms an essential complex with protein phosphatase 1 (PP1) gamma and is required for the recruitment of PP1 to chromatin

AA Sequence

MDANSKDKPPETKESAMNNAGNASFILGTGKIVTPQKHAELPPNPCTPDTFKSPLNFSTVTVEQLGITPE      1 - 70
SFVRNSAGKSSSYLKKCRRRSAVGARGSPETNHLIRFIARQQNIKNARKSPLAQDSPSQGSPALYRNVNT     71 - 140
LRERISAFQSAFHSIKENEKMTGCLEFSEAGKESEMTDLTRKEGLSACQQSGFPAVLSSKRRRISYQRDS    141 - 210
DENLTDAEGKVIGLQIFNIDTDRACAVETSVDLSEISSKLGSTQSGFLVEESLPLSELTETSNALKVADC    211 - 280
VVGKGSSDAVSPDTFTAEVSSDAVPDVRSPATPACRRDLPTPKTFVLRSVLKKPSVKMCLESLQEHCNNL    281 - 350
YDDDGTHPSLISNLPNCCKEKEAEDEENFEAPAFLNMRKRKRVTFGEDLSPEVFDESLPANTPLRKGGTP    351 - 420
VCKKDFSGLSSLLLEQSPVPEPLPQPDFDDKGENLENIEPLQVSFAVLSSPNKSSISETLSGTDTFSSSN    421 - 490
NHEKISSPKVGRITRTSNRRNQLVSVVEESVCNLLNTEVQPCKEKKINRRKSQETKCTKRALPKKSQVLK    491 - 560
SCRKKKGKGKKSVQKSLYGERDIASKKPLLSPIPELPEVPEMTPSIPSIRRLGSGYFSSNGKLEEVKTPK    561 - 630
NPVKRKDLLRHDPDLHMHQGYDKYDVSEFCSYIKSSSSLGNATSDEDPNTNIMNINENKNIPKAKNKSES    631 - 700
ENEPKAGTDSPVSCASVTEERVASDSPKPALTLQQGQEFSAGGQNAENLCQFFKISPDLNIKCERKDDFL    701 - 770
GAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGR    771 - 840
SLHLEKNGNHTPSSSVGSSVEISLENSELFKDLSDAIEQTFQRRNSETKVRRSTRLQKDLENEGLVWISL    841 - 910
PLPSTSQKAKRRTICTFDSSGFESMSPIKETVSSRQKPQMAPPVSDPENSQGPAAGSSDEPGKRRKSFCI    911 - 980
STLANTKATSQFKGYRRRSSLNGKGESSLTALERIEHNGERKQ                               981 - 1023
//

Text Mined References (25)

PMID Year Title
24563358 2014 Repo-man at the intersection of chromatin remodelling, DNA repair, nuclear envelope organization, and cancer progression.
23746640 2013 Aurora B defines its own chromosomal targeting by opposing the recruitment of the phosphatase scaffold Repo-Man.
23418564 2013 Overexpression of CDCA2 in human squamous cell carcinoma: correlation with prevention of G1 phase arrest and apoptosis.
23362328 2013 Quantitative fragmentome mapping reveals novel, domain-specific partners for the modular protein RepoMan (recruits PP1 onto mitotic chromatin at anaphase).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22801782 2012 Sds22 and Repo-Man stabilize chromosome segregation by counteracting Aurora B on anaphase kinetochores.
22555598 2012 Repo-Man-PP1: a link between chromatin remodelling and nuclear envelope reassembly.
21820363 2011 Repo-Man coordinates chromosomal reorganization with nuclear envelope reassembly during mitotic exit.
21514157 2011 PP1/Repo-man dephosphorylates mitotic histone H3 at T3 and regulates chromosomal aurora B targeting.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...