Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.6e-07

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer -1.500 1.6e-07

AA Sequence

MAERPGPPGGAVSATAYPDTPAEFPPHLQAGAMRRRFWGVFNCLCAGAFGALAAASAKLAFGSEVSMGLC      1 - 70
VLGIIVMASTNSLMWTFFSRGLSFSMSSAIASVTVTFSNILSSAFLGYVLYGECQEVLWWGGVFLILCGL     71 - 140
TLIHRKLPPTWKPLPHKQQ                                                       141 - 159
//

Text Mined References (4)

PMID Year Title