Property Summary

NCBI Gene PubMed Count 20
PubMed Score 74.40
PubTator Score 28.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Hartnup disease 13 7.377 3.7
Hyperglycinuria 3 0.0 0.0
Iminoglycinuria 4 0.0 0.0
Disease Target Count
HYPERGLYCINURIA (disorder) 12
Disease Target Count P-value
ovarian cancer 8520 1.0e-08
osteosarcoma 7950 3.2e-07
medulloblastoma, large-cell 6241 3.3e-04
atypical teratoid / rhabdoid tumor 5112 6.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Pellagra 26 4.706 2.4
Microsporidiosis 13 3.399 1.7
Cystinuria 18 3.036 1.5
Disease Target Count
Hartnup Disorder 1

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 6.6e-03
medulloblastoma, large-cell 1.400 3.3e-04
osteosarcoma 1.269 3.2e-07
ovarian cancer 1.300 1.0e-08

Gene RIF (12)

AA Sequence

MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNKAQYMLTCLGFCVGLGNVWRFPYLCQSHGGGAF      1 - 70
MIPFLILLVLEGIPLLYLEFAIGQRLRRGSLGVWSSIHPALKGLGLASMLTSFMVGLYYNTIISWIMWYL     71 - 140
FNSFQEPLPWSDCPLNENQTGYVDECARSSPVDYFWYRETLNISTSISDSGSIQWWMLLCLACAWSVLYM    141 - 210
CTIRGIETTGKAVYITSTLPYVVLTIFLIRGLTLKGATNGIVFLFTPNVTELAQPDTWLDAGAQVFFSFS    211 - 280
LAFGGLISFSSYNSVHNNCEKDSVIVSIINGFTSVYVAIVVYSVIGFRATQRYDDCFSTNILTLINGFDL    281 - 350
PEGNVTQENFVDMQQRCNASDPAAYAQLVFQTCDINAFLSEAVEGTGLAFIVFTEAITKMPLSPLWSVLF    351 - 420
FIMLFCLGLSSMFGNMEGVVVPLQDLRVIPPKWPKEVLTGLICLGTFLIGFIFTLNSGQYWLSLLDSYAG    421 - 490
SIPLLIIAFCEMFSVVYVYGVDRFNKDIEFMIGHKPNIFWQVTWRVVSPLLMLIIFLFFFVVEVSQELTY    491 - 560
SIWDPGYEEFPKSQKISYPNWVYVVVVIVAGVPSLTIPGYAIYKLIRNHCQKPGDHQGLVSTLSTASMNG    561 - 630
DLKY                                                                      631 - 634
//

Text Mined References (20)

PMID Year Title