Property Summary

NCBI Gene PubMed Count 9
PubMed Score 8.13
PubTator Score 7.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.415 0.000
posterior fossa group A ependymoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.200 0.003
spina bifida -1.434 0.033

Gene RIF (4)

PMID Text
25045667 Our study demonstrates and supports that KCTD11, as well as negatively regulated downstream effectors belonging to Hh signaling, plays a role in prostate cancer pathogenesis.
21237243 the protein is expressed in two alternative variants: a short previously characterized form (sKCTD11) composed by 232 amino acids and a longer variant (lKCTD11) which contains an N-terminal extension of 39 residues.
20591193 findings identify KCTD11 as a widely down-regulated gene in human cancers, and provide a basis to understand how its expression might be deregulated in tumor cells
15249678 Results identify REN(KCTD11) as a suppressor of Hedgehog signaling and suggest that its inactivation might lead to a deregulation of the tumor-promoting Hedgehog pathway in medulloblastoma.

AA Sequence

MLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLL      1 - 70
DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRAR     71 - 140
FGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGERREVVGTPSFLEEVLRVALEHGFR    141 - 210
LDSVFPDPEDLLNSRSLRFVRH                                                    211 - 232
//

Text Mined References (10)

PMID Year Title
25045667 2014 KCTD11 tumor suppressor gene expression is reduced in prostate adenocarcinoma.
21472142 2011 Identification and characterization of KCASH2 and KCASH3, 2 novel Cullin3 adaptors suppressing histone deacetylase and Hedgehog activity in medulloblastoma.
21237243 2011 Molecular organization of the cullin E3 ligase adaptor KCTD11.
20591193 2010 The tumor suppressor gene KCTD11REN is regulated by Sp1 and methylation and its expression is reduced in tumors.
20081843 2010 Histone deacetylase and Cullin3-REN(KCTD11) ubiquitin ligase interplay regulates Hedgehog signalling through Gli acetylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15249678 2004 REN(KCTD11) is a suppressor of Hedgehog signaling and is deleted in human medulloblastoma.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12186855 2002 REN: a novel, developmentally regulated gene that promotes neural cell differentiation.