Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.77
PubTator Score 7.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ependymoma 4679 2.8e-12
osteosarcoma 7950 9.4e-05
atypical teratoid / rhabdoid tumor 5112 3.4e-03
spina bifida 1074 3.3e-02
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
medulloblastoma 720 4.591 2.3

Expression

  Differential Expression (4)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 3.4e-03
ependymoma 1.400 2.8e-12
osteosarcoma -1.415 9.4e-05
spina bifida -1.434 3.3e-02

Gene RIF (4)

AA Sequence

MLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLL      1 - 70
DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRAR     71 - 140
FGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGERREVVGTPSFLEEVLRVALEHGFR    141 - 210
LDSVFPDPEDLLNSRSLRFVRH                                                    211 - 232
//

Text Mined References (12)

PMID Year Title