Property Summary

NCBI Gene PubMed Count 40
PubMed Score 0.00
PubTator Score 14.33

Knowledge Summary

Patent

No data available

Gene RIF (5)

AA Sequence

MNPSEMQRKAPPRRRRHRNRAPLTHKMNKMVTSEEQMKLPSTKKAEPPTWAQLKKLTQLATKYLENTKVT      1 - 70
QTPESMLLAALMIVSMVSAGVPNSSEETATIENGP                                        71 - 105
//

Text Mined References (40)

PMID Year Title