Property Summary

NCBI Gene PubMed Count 4
Grant Count 1
Funding $241,736.67
PubMed Score 2.31
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 0.000

Gene RIF (1)

PMID Text
17498703 a cytosolic enzyme, expressed in skeletal muscle, liver and adipose tissue, suggesting its possible role in energy metabolism

AA Sequence

MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATA      1 - 70
LDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDH     71 - 140
SKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQ    141 - 210
DGEEEDGREL                                                                211 - 220
//

Text Mined References (6)

PMID Year Title
25390645 2014 Genome-wide and gene-based association studies of anxiety disorders in European and African American samples.
21543850 2011 Structure of human dual-specificity phosphatase 27 at 2.38?Å resolution.
19851299 2010 Linkage and genome-wide association analysis of obesity-related phenotypes: association of weight with the MGAT1 gene.
17498703 2007 Identification and characterization of DUSP27, a novel dual-specific protein phosphatase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.