Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.53
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
psoriasis 6694 3.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.1
Disease Target Count
Genitopatellar Syndrome 2

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.600 3.5e-04

Gene RIF (2)

AA Sequence

MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWPKLYIGDEATA      1 - 70
LDRYRLQKAGFTHVLNAAHGRWNVDTGPDYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDH     71 - 140
SKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKNRCVLPNRGFLKQLRELDKQLVQQRRRSQRQ    141 - 210
DGEEEDGREL                                                                211 - 220
//

Text Mined References (8)

PMID Year Title