Property Summary

NCBI Gene PubMed Count 4
PubMed Score 25.23
PubTator Score 13.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
group 3 medulloblastoma 2254 1.51620602799789E-7
non-small cell lung cancer 2798 6.62072585931738E-7
pancreatic cancer 2300 2.34865914217703E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 8.90936491879506E-5
lung adenocarcinoma 2714 3.96950122835969E-4
ovarian cancer 8492 8.72079674270825E-4
atypical teratoid / rhabdoid tumor 4369 0.00228476924188583
cystic fibrosis and chronic rhinosinusitis 213 0.00503721986256385
primitive neuroectodermal tumor 3031 0.0115967893859027
glioblastoma 5572 0.0378266792192337

Expression

Gene RIF (2)

PMID Text
20682177 Of the prostate cancer samples, 10, 10, 23 and 40% showed ODF1, ODF2, LEMD1 and SPATA19 specific bands, respectively, but none of the BPH samples expressed any of these genes.
15254688 LEM domain-containing 1 is a novel testis-specific gene expressed in colorectal cancers

AA Sequence

MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDGAQDSDDSEEL      1 - 70
NIILQGNIILSTEKSKKLKKWPEASTTKRKAVDTYCLDYKPSKGRRWAARAPSTRITYGTITKERDYCAE     71 - 140
DQTIESWREEGFPVGLKLAVLGIFIIVVFVYLTVENKSLFG                                 141 - 181
//

Text Mined References (5)

PMID Year Title
20682177 2010 Expression of two testis-specific genes, SPATA19 and LEMD1, in prostate cancer.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254688 2004 Isolation of LEM domain-containing 1, a novel testis-specific gene expressed in colorectal cancers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.