Property Summary

NCBI Gene PubMed Count 6
PubMed Score 28.12
PubTator Score 13.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (4)

AA Sequence

MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDGAQDSDDSEEL      1 - 70
NIILQGNIILSTEKSKKLKKWPEASTTKRKAVDTYCLDYKPSKGRRWAARAPSTRITYGTITKERDYCAE     71 - 140
DQTIESWREEGFPVGLKLAVLGIFIIVVFVYLTVENKSLFG                                 141 - 181
//

Text Mined References (7)

PMID Year Title