Property Summary

NCBI Gene PubMed Count 4
PubMed Score 25.23
PubTator Score 13.33

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20682177 Of the prostate cancer samples, 10, 10, 23 and 40% showed ODF1, ODF2, LEMD1 and SPATA19 specific bands, respectively, but none of the BPH samples expressed any of these genes.
15254688 LEM domain-containing 1 is a novel testis-specific gene expressed in colorectal cancers

AA Sequence

MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDGAQDSDDSEEL      1 - 70
NIILQGNIILSTEKSKKLKKWPEASTTKRKAVDTYCLDYKPSKGRRWAARAPSTRITYGTITKERDYCAE     71 - 140
DQTIESWREEGFPVGLKLAVLGIFIIVVFVYLTVENKSLFG                                 141 - 181
//

Text Mined References (5)

PMID Year Title
20682177 2010 Expression of two testis-specific genes, SPATA19 and LEMD1, in prostate cancer.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254688 2004 Isolation of LEM domain-containing 1, a novel testis-specific gene expressed in colorectal cancers.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.