Property Summary

NCBI Gene PubMed Count 23
PubMed Score 40.57
PubTator Score 19.92

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 2.900 2.7e-06
medulloblastoma, large-cell 3.600 3.2e-02

Gene RIF (11)

AA Sequence

MQILSRCQGLMSEECGRTTALAAGRTRKGAGEEGLVSPEGAGDEDSCSSSAPLSPSSSPRSMASGSGCPP      1 - 70
GKCVCNSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDKDIFCKLDYFRRYGTRCSRCG     71 - 140
RHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALVEEKVLCRVHYDCMLDNLKREVENGNGISVE    141 - 210
GALLTEQDVNHPKPAKRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARH    211 - 280
KKHVSPNHSSSTPVTAVPPSRLSPPMLEEMAYSAYVPQDGTMLTALHSYMDAHSPTTLGLQPLLPHSMTQ    281 - 350
LPISHT                                                                    351 - 356
//

Text Mined References (25)

PMID Year Title