Property Summary

NCBI Gene PubMed Count 22
Grant Count 24
R01 Count 16
Funding $2,456,794.95
PubMed Score 37.53
PubTator Score 19.92

Knowledge Summary

Patent

No data available

Gene RIF (11)

PMID Text
24316404 Increasing Lhx8 expression in neuronal cell lines also increased acetylcholine release.
22435649 Our tagging-single nucleotide polymorphism (tSNP)-based association analysis was negative for Tourette syndrome association with LHX8.
21143530 LHX8 might play an important role in odontoma formation. This is 1st report on comparison of LHX8 expression between human odontoma-derived mesenchymal cells and normal adult dental mesenchymal stem cells and its overexpression in human samples.
20672350 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20572854 Observational study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
17624344 Mutations in the LHX8 exons are uncommon in Caucasian women with premature ovarian failure.
17624344 Observational study of gene-disease association. (HuGE Navigator)
16690745 Sohlh1 and Lhx8 are two germ cell-specific, critical regulators of oogenesis
More...

AA Sequence

MQILSRCQGLMSEECGRTTALAAGRTRKGAGEEGLVSPEGAGDEDSCSSSAPLSPSSSPRSMASGSGCPP      1 - 70
GKCVCNSCGLEIVDKYLLKVNDLCWHVRCLSCSVCRTSLGRHTSCYIKDKDIFCKLDYFRRYGTRCSRCG     71 - 140
RHIHSTDWVRRAKGNVYHLACFACFSCKRQLSTGEEFALVEEKVLCRVHYDCMLDNLKREVENGNGISVE    141 - 210
GALLTEQDVNHPKPAKRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARH    211 - 280
KKHVSPNHSSSTPVTAVPPSRLSPPMLEEMAYSAYVPQDGTMLTALHSYMDAHSPTTLGLQPLLPHSMTQ    281 - 350
LPISHT                                                                    351 - 356
//

Publication (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24316404 2014 Upregulation of Lhx8 increase VAChT expression and ACh release in neuronal cell line SHSY5Y.
22435649 2012 Evaluation of the LIM homeobox genes LHX6 and LHX8 as candidates for Tourette syndrome.
22204396 2012 Pharmacological modulation of the Hedgehog pathway differentially affects dorsal/ventral patterning in mouse and human embryonic stem cell models of telencephalic development.
21856374 2012 Oogenesis: transcriptional regulators and mouse models.
21462296 2011 Variation in FGF1, FOXE1, and TIMP2 genes is associated with nonsyndromic cleft lip with or without cleft palate.
21143530 2011 Comparative study of LHX8 expression between odontoma and dental tissue-derived stem cells.
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20572854 2010 MTHFR and MSX1 contribute to the risk of nonsyndromic cleft lip/palate.
More...