Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 8.29128941640871E-19
Pick disease 1893 2.78002285152162E-6
pediatric high grade glioma 2712 4.0681534738138E-5
glioblastoma 5572 4.20733274102172E-5
atypical teratoid / rhabdoid tumor 4369 9.26808490426658E-4
oligodendroglioma 2849 0.0277899320338519
subependymal giant cell astrocytoma 2287 0.049981070524997

Expression

  Differential Expression (7)

Disease log2 FC p
oligodendroglioma 1.100 0.028
atypical teratoid / rhabdoid tumor -1.500 0.001
glioblastoma -1.500 0.000
pediatric high grade glioma -1.300 0.000
subependymal giant cell astrocytoma -1.298 0.050
lung carcinoma 1.200 0.000
Pick disease -1.500 0.000

Synonym

Accession Q68EN5 A2VCS8 Q8N3H9 Q8NAQ5 Q96IE5
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid

AA Sequence

MVLDSGAQAYDQAPPSPPTSPPSLRHRLKPSDRDGPPLYPWSQSLALPLALAVPPALQPQPEQQPFSQML      1 - 70
LGHRGHMRRSESTYSVNSTGRRGRGTLGRPPPGRGRNPGGGTLRPAASLPHIAKTQRDAGHIASKSPCML     71 - 140
VALRPTNMDRERDKFFQSHYTYNPQFEYQEPMPTAVLEKYCEASGQFIHQAVGIIEAVLEKFGTYEHFEA    141 - 210
ATGGQLLTKCQIWSIVRKYMQKEGCAGEVVVQLSEDLLSQAVMMVENSRPTLAINLTGARQYWLEGMLRH    211 - 280
EIGTHYLRGVNNARQPWHNAEGRLRYGLRPANPTEEGLASLHSVLFRKQPFLWRAALLYYTIHRAARMSF    281 - 350
RQLFQDLERYVQDADVRWEYCVRAKRGQTDTSLPGCFSKDQVYLDGIVRILRHRQTIDFPLLTSLGKVSY    351 - 420
EDVDHLRPHGVLDNTRVPHFMQDLARYRQQLEHIMATNRLDEAELGRLLPD                       421 - 471
//

Text Mined References (4)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.