Property Summary

NCBI Gene PubMed Count 14
PubMed Score 63.62
PubTator Score 10.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Syringomyelia 15 3.596 1.8

Expression

Synonym

Accession Q68EM7 A8K6M6 Q6ZUS4 Q7Z2F2 Q8NDG2 Q96KS2 Q96KS3 Q96SS8 Q9BVF6 Q9H8U5 Q9NW54
Symbols PP367
RICH1
WBP15
MST066
MST110
NADRIN
PP4534
RICH-1
MSTP038
MSTP066
MSTP110

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (2)

Gene RIF (4)

AA Sequence

MKKQFNRMKQLANQTVGRAEKTEVLSEDLLQIERRLDTVRSICHHSHKRLVACFQGQHGTDAERRHKKLP      1 - 70
LTALAQNMQEASTQLEDSLLGKMLETCGDAENQLALELSQHEVFVEKEIVDPLYGIAEVEIPNIQKQRKQ     71 - 140
LARLVLDWDSVRARWNQAHKSSGTNFQGLPSKIDTLKEEMDEAGNKVEQCKDQLAADMYNFMAKEGEYGK    141 - 210
FFVTLLEAQADYHRKALAVLEKTLPEMRAHQDKWAEKPAFGTPLEEHLKRSGREIALPIEACVMLLLETG    211 - 280
MKEEGLFRIGAGASKLKKLKAALDCSTSHLDEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWTQVASV    281 - 350
QDQDKKLQDLWRTCQKLPPQNFVNFRYLIKFLAKLAQTSDVNKMTPSNIAIVLGPNLLWARNEGTLAEMA    351 - 420
AATSVHVVAVIEPIIQHADWFFPEEVEFNVSEAFVPLTTPSSNHSFHTGNDSDSGTLERKRPASMAVMEG    421 - 490
DLVKKESFGVKLMDFQAHRRGGTLNRKHISPAFQPPLPPTDGSTVVPAGPEPPPQSSRAESSSGGGTVPS    491 - 560
SAGILEQGPSPGDGSPPKPKDPVSAAVPAPGRNNSQIASGQNQPQAAAGSHQLSMGQPHNAAGPSPHTLR    561 - 630
RAVKKPAPAPPKPGNPPPGHPGGQSSSGTSQHPPSLSPKPPTRSPSPPTQHTGQPPGQPSAPSQLSAPRR    631 - 700
YSSSLSPIQAPNHPPPQPPTQATPLMHTKPNSQGPPNPMALPSEHGLEQPSHTPPQTPTPPSTPPLGKQN    701 - 770
PSLPAPQTLAGGNPETAQPHAGTLPRPRPVPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDS    771 - 840
NSRVSEPHRSIFPEMHSDSASKDVPGRILLDIDNDTESTAL                                 841 - 881
//

Text Mined References (24)

PMID Year Title