Property Summary

NCBI Gene PubMed Count 20
Grant Count 8
Funding $1,879,037.74
PubMed Score 6.53
PubTator Score 5.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

PMID Text
23986477 In response to the DNA damage response, INTS3-hSSB1-INTS6 complex relocates to the DNA damage sites.
19786574 INTS3 controls the hSSB1-mediated DNA damage response.
19759019 INT3 plays a key role in the DNA damage response
19683501 INTS3 is part of an ssDNA-binding heterotrimeric complex, SOSS which is involved in the maintenance of genome stability.

AA Sequence

MELQKGKGAAAAAAASGAAGGGGGGAGAGAPGGGRLLLSTSLDAKDELEERLERCMSIVTSMTAGVSERE      1 - 70
ANDALNAYVCKGLPQHEEICLGLFTLILTEPAQAQKCYRDLALVSRDGMNIVLNKINQILMEKYLKLQDT     71 - 140
CRTQLVWLVRELVKSGVLGADGVCMTFMKQIAGGGDVTAKNIWLAESVLDILTEQREWVLKSSILIAMAV    141 - 210
YTYLRLIVDHHGTAQLQALRQKEVDFCISLLRERFMECLMIGRDLVRLLQNVARIPEFELLWKDIIHNPQ    211 - 280
ALSPQFTGILQLLQSRTSRKFLACRLTPDMETKLLFMTSRVRFGQQKRYQDWFQRQYLSTPDSQSLRCDL    281 - 350
IRYICGVVHPSNEVLSSDILPRWAIIGWLLTTCTSNVAASNAKLALFYDWLFFSPDKDSIMNIEPAILVM    351 - 420
HHSMKPHPAITATLLDFMCRIIPNFYPPLEGHVRQGVFSSLNHIVEKRVLAHLAPLFDNPKLDKELRAML    421 - 490
REKFPEFCSSPSPPVEVKIEEPVSMEMDNHMSDKDESCYDNAEAAFSDDEEDLNSKGKKREFRFHPIKET    491 - 560
VVEEPVDITPYLDQLDESLRDKVLQLQKGSDTEAQCEVMQEIVDQVLEEDFDSEQLSVLASCLQELFKAH    561 - 630
FRGEVLPEEITEESLEESVGKPLYLIFRNLCQMQEDNSSFSLLLDLLSELYQKQPKIGYHLLYYLRASKA    631 - 700
AAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPDETLRSGELLNMIVAVIDS    701 - 770
AQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEA    771 - 840
LSCLLLQLRREKPSEEMVKMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKSLLIKNNSLPRKRQSLR    841 - 910
SSSSKLAQLTLEQILEHLDNLRLNLTNTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDS    911 - 980
STKPPKSRRKAALSSPRSRKNATQPPNAEEESGSSSASEEEDTKPKPTKRKRKGSSAVGSDSD           981 - 1043
//

Text Mined References (29)

PMID Year Title
25916848 2015 RPA70 depletion induces hSSB1/2-INTS3 complex to initiate ATR signaling.
25675981 2015 The Integrator complex controls the termination of transcription at diverse classes of gene targets.
25609707 2015 Subnuclear domain proteins in cancer cells support the functions of RUNX2 in the DNA damage response.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23986477 2013 A core hSSB1-INTS complex participates in the DNA damage response.
23459151 2013 Single strand DNA binding proteins 1 and 2 protect newly replicated telomeres.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...