Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
interstitial cystitis -1.400 8.2e-04
intraductal papillary-mucinous neoplasm ... -1.300 3.1e-04
ovarian cancer -2.400 2.3e-07
sonic hedgehog group medulloblastoma 1.200 2.4e-06

AA Sequence

MGPLQFRDVAIEFSLEEWHCLDTAQRNLYRNVMLENYSNLVFLGITVSKPDLITCLEQGRKPLTMKRNEM      1 - 70
IAKPSVMCSHFAQDLWPEQSMKDSFQKVVLRRYEKCEHDNLQLKKGCISVDECKVHKEGYNELNQCLTTT     71 - 140
PRKICQCDKYVKVLHQFPNSNGQKRGHTGKKPFKYIECGKAFKQFSTLTTHKKIHTGGKPYKCEECGKAF    141 - 210
NHSCSLTRHKKIHTGEKPYKCEECGKAFKHSSTLTTHKRNHTGEKPYKCDKCGKAFMSSSTLSKHEIIHT    211 - 280
EKKPYKCEECGKAFNRSSTLTTHKIIHTGEKPYKCEECDKAFKYSYTLTTHKRIHTEDKPYKCEECGKAF    281 - 350
KYSSTLTTHKRIHTGEKPYKCEECGKAFKRSSDLTTHKIIHTGEKPYKCEECGKAFKYSSNLTTHKKIHT    351 - 420
GERPYKCEECGKAFNQSSILTTHRRIHTGEKFYKCEECGKAFKCSSNLTTHKKIHTGERPYKCEECGKAF    421 - 490
NQSSILTTHERIILERNSTNVKNVAKPSSGPHTLLHIR                                    491 - 528
//

Text Mined References (6)

PMID Year Title