Property Summary

NCBI Gene PubMed Count 37
PubMed Score 55.03
PubTator Score 35.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
colon cancer 1.500 4.1e-02
ductal carcinoma in situ 1.500 2.3e-02
ependymoma 2.400 1.8e-06
interstitial cystitis -1.200 2.7e-04
intraductal papillary-mucinous carcinoma... 1.500 2.6e-04
intraductal papillary-mucinous neoplasm ... 1.100 5.0e-03
invasive ductal carcinoma 2.100 2.6e-02
lung adenocarcinoma 1.400 3.2e-05
lung cancer 2.800 7.0e-06
non-small cell lung cancer 1.231 4.2e-12

Protein-protein Interaction (8)

Gene RIF (26)

AA Sequence

MSGGHQLQLAALWPWLLMATLQAGFGRTGLVLAAAVESERSAEQKAIIRVIPLKMDPTGKLNLTLEGVFA      1 - 70
GVAEITPAEGKLMQSHPLYLCNASDDDNLEPGFISIVKLESPRRAPRPCLSLASKARMAGERGASAVLFD     71 - 140
ITEDRAAAEQLQQPLGLTWPVVLIWGNDAEKLMEFVYKNQKAHVRIELKEPPAWPDYDVWILMTVVGTIF    141 - 210
VIILASVLRIRCRPRHSRPDPLQQRTAWAISQLATRRYQASCRQARGEWPDSGSSCSSAPVCAICLEEFS    211 - 280
EGQELRVISCLHEFHRNCVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSYQEPGRRLHLIRQHPGHAH    281 - 350
YHLPAAYLLGPSRSAVARPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQQRLAGAQHPYAQGWGLSH    351 - 420
LQSTSQHPAACPVPLRRARPPDSSGSGESYCTERSGYLADGPASDSSSGPCHGSSSDSVVNCTDISLQGV    421 - 490
HGSSSTFCSSLSSDFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTGETQVSSHVHYHRHRHHHYKK    491 - 560
RFQWHGRKPGPETGVPQSRPPIPRTQPQPEPPSPDQQVTRSNSAAPSGRLSNPQCPRALPEPAPGPVDAS    561 - 630
SICPSTSSLFNLQKSSLSARHPQRKRRGGPSEPTPGSRPQDATVHPACQIFPHYTPSVAYPWSPEAHPLI    631 - 700
CGPPGLDKRLLPETPGPCYSNSQPVWLCLTPRQPLEPHPPGEGPSEWSSDTAEGRPCPYPHCQVLSAQPG    701 - 770
SEEELEELCEQAV                                                             771 - 783
//

Text Mined References (42)

PMID Year Title