Property Summary

NCBI Gene PubMed Count 31
Grant Count 127
Funding $85,324,537.5
PubMed Score 51.59
PubTator Score 35.31

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q68DV7 A8K4R2 B7Z443 B7Z5D5 B7Z5J5 Q65ZA4 Q6AI04 Q9NXD0
Symbols URCC
SSPCS
RNF124

Gene

PDB

4KNG  

 GWAS Trait (1)

Gene RIF (20)

PMID Text
26823834 our study exhibited the expression patterns and correlation of RNF43 and p53 pathway proteins involved in cell cycling
26350900 RNF43 inhibits the Wnt pathway downstream of oncogenic mutations that activate the pathway.
26297255 RNF43 gene harbored not only exceedingly high mutations but also mutational intratumoral heterogeneity, which together might play a role in tumorigenesis of gastric and colorectal cancers.
26184844 RNF43 might act as a tumor suppressor in gastric carcinoma and might be a potential indicator for the clinical assessment of gastric cancer prognosis
25996295 The nucleoprotein of influenza A virus targets RNF43 to modulate p53 ubiquitination levels and hence causes p53 stabilization which is conducive to an enhanced apoptosis level in the host cells.
25961913 Authors also identified ring finger 43 (RNF43), an inhibitor of Wnt/beta-catenin signaling, as a target of miR-550a-5p.
25891077 Data indicate Dishevelled (DVL) as a dual function adaptor to recruit negative regulators ZNRF3/RNF43 to Wnt receptors to ensure proper control of pathway activity.
25825523 Missense mutations of RNF43 change their localization from the endosome to the endoplasmic reticulum.
25755738 we found that the decreased expression of RNF43 in glioma was associated with poor prognosis by the Kaplan-Meier survival analysis. Importantly, multivariate analysis suggested RN43 as an independent predictor of overall survival.
25344691 RNF43 is one of the most commonly mutated genes in colorectal and endometrial cancers
More...

AA Sequence

MSGGHQLQLAALWPWLLMATLQAGFGRTGLVLAAAVESERSAEQKAIIRVIPLKMDPTGKLNLTLEGVFA      1 - 70
GVAEITPAEGKLMQSHPLYLCNASDDDNLEPGFISIVKLESPRRAPRPCLSLASKARMAGERGASAVLFD     71 - 140
ITEDRAAAEQLQQPLGLTWPVVLIWGNDAEKLMEFVYKNQKAHVRIELKEPPAWPDYDVWILMTVVGTIF    141 - 210
VIILASVLRIRCRPRHSRPDPLQQRTAWAISQLATRRYQASCRQARGEWPDSGSSCSSAPVCAICLEEFS    211 - 280
EGQELRVISCLHEFHRNCVDPWLHQHRTCPLCMFNITEGDSFSQSLGPSRSYQEPGRRLHLIRQHPGHAH    281 - 350
YHLPAAYLLGPSRSAVARPPRPGPFLPSQEPGMGPRHHRFPRAAHPRAPGEQQRLAGAQHPYAQGWGLSH    351 - 420
LQSTSQHPAACPVPLRRARPPDSSGSGESYCTERSGYLADGPASDSSSGPCHGSSSDSVVNCTDISLQGV    421 - 490
HGSSSTFCSSLSSDFDPLVYCSPKGDPQRVDMQPSVTSRPRSLDSVVPTGETQVSSHVHYHRHRHHHYKK    491 - 560
RFQWHGRKPGPETGVPQSRPPIPRTQPQPEPPSPDQQVTRSNSAAPSGRLSNPQCPRALPEPAPGPVDAS    561 - 630
SICPSTSSLFNLQKSSLSARHPQRKRRGGPSEPTPGSRPQDATVHPACQIFPHYTPSVAYPWSPEAHPLI    631 - 700
CGPPGLDKRLLPETPGPCYSNSQPVWLCLTPRQPLEPHPPGEGPSEWSSDTAEGRPCPYPHCQVLSAQPG    701 - 770
SEEELEELCEQAV                                                             771 - 783
//

Text Mined References (34)

PMID Year Title
26823834 2015 Association of RNF43 with cell cycle proteins involved in p53 pathway.
26350900 2015 The E3 ligase RNF43 inhibits Wnt signaling downstream of mutated ?-catenin by sequestering TCF4 to the nuclear membrane.
26297255 2015 Frequent frameshift mutations in 2 mononucleotide repeats of RNF43 gene and its regional heterogeneity in gastric and colorectal cancers.
26184844 2015 RNF43 Inhibits Cancer Cell Proliferation and Could be a Potential Prognostic Factor for Human Gastric Carcinoma.
25996295 2015 The nucleoprotein of influenza A virus induces p53 signaling and apoptosis via attenuation of host ubiquitin ligase RNF43.
25961913 2016 Brg-1 targeting of novel miR550a-5p/RNF43/Wnt signaling axis regulates colorectal cancer metastasis.
25891077 2015 Dishevelled promotes Wnt receptor degradation through recruitment of ZNRF3/RNF43 E3 ubiquitin ligases.
25825523 2015 Molecular Role of RNF43 in Canonical and Noncanonical Wnt Signaling.
25755738 2015 Downregulation of ring-finger protein 43 in glioma associates with poor prognosis.
25344691 2014 RNF43 is frequently mutated in colorectal and endometrial cancers.
More...