Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Synonym

Accession Q68DL7 A6NME8
Symbols DKFZP781G0119

Gene

 Compartment GO Term (1)

AA Sequence

MNDSRQQSLFFITLPDLNKLCAVRIILSNKVADTEIRTIQMKMCRQLLFLHQDILTSPVSGILNQIWVVM      1 - 70
AIPFYKARKLNAYVEKYGAKMEAPQRVIPVILQNCLSYSFMARLAPAWNRTGHLLIQGRDFLSQMGKQSA     71 - 140
VVLNINVTETQVCLSIEACTIRLPAPELKEFEISQSIIKDFHANKHAVIERHSILSNWCYVLPSMKMGQI    141 - 210
INIFHAIPAACPFHSYGDFQRHWDALYGYKLPGDCGKIKIYCNIYFKMLGERTFTYPLSCIRSQPMQFFP    211 - 280
RVDSEVVLKSFLSDLKSKLPHICGFPIKMTSKPCYYTQELTKPNIQEHKVKPPNLTTKKMLRASLTQATS    281 - 350
RKPACAQSLLPCSVAVDHKVELSVSQPTSGIFSALHLQPESVQGRKKSLSIRAPQVHSEVLMPNRGNTQV    351 - 420
QHTNLSSQSNITPKFVPVFKNRLLQMNKNTSVLGSPKRKQHDVTQSKLFSLKTSMIQHDKLNLGPAIKNR    421 - 490
YSSNIQMQAANNLNQENSRPLQEKNTESSENMTKFPSSRGKSTVSLNKNKQLSNSAVFVVSNNNLGVVKS    491 - 560
AVDFQMKGKENLTGKGITQILGKSHGSLKLKRQPHIFESDGETEDPRLLQQQSENQAKEVGTSDHRLIVS    561 - 630
KIAHRSKRKLCPESSKTSKKHHSDTVHYGQSSSSKKQILDSDKSKLKKSLIIHNA                   631 - 685
//

Text Mined References (2)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16177791 2005 DNA sequence and analysis of human chromosome 18.