Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.047 4.3e-04
adult high grade glioma -1.300 1.5e-03
astrocytic glioma -1.400 1.3e-02
atypical teratoid / rhabdoid tumor -2.500 5.1e-08
diabetes mellitus -1.300 2.9e-03
ependymoma -1.900 1.4e-02
glioblastoma -1.800 1.6e-05
hereditary spastic paraplegia -1.104 1.7e-02
intraductal papillary-mucinous neoplasm ... 1.900 6.5e-03
lung carcinoma 1.200 3.1e-19
medulloblastoma -1.300 3.1e-04
medulloblastoma, large-cell -2.000 3.1e-05
ovarian cancer -1.300 6.7e-04
pancreatic ductal adenocarcinoma liver m... -1.477 2.0e-02
primitive neuroectodermal tumor -1.200 3.2e-04

AA Sequence

MSGAALGLEIVFVFFLALFLLHRYGDFKKQHRLVIIGTLLAWYLCFLIVFILPLDVSTTIYNRCKHAAAN      1 - 70
SSPPENSNITGLYATANPVPSQHPCFKPWSYIPDGIMPIFWRVVYWTSQFLTWILLPFMQSYARSGGFSI     71 - 140
TGKIKTALIENAIYYGTYLLIFGAFLIYVAVNPHLHLEWNQLQTIGIAAANTWGLFLLVLLLGYGLVEIP    141 - 210
RSYWNGAKRGYLLMKTYFKAAKLMTEKADAEENLEDAMEEVRKVNESIKYNHPLRKCVDTILKKCPTEYQ    211 - 280
EKMGRNMDDYEDFDEKHSIYPSEKSLVKLHKQVIYSVQRHRRTQVQWQILLEQAFYLEDVAKNETSATHQ    281 - 350
FVHTFQSPEPENRFIQYFYNPTFEWYWECLLRPWFYKILAVVLSIFSVIVVWSECTFFSTTPVLSLFAVF    351 - 420
IQLAEKTYNYIYIEIACFLSIFFLSICVYSTVFRIRVFNYYYLASHHQTDAYSLLFSGMLFCRLTPPLCL    421 - 490
NFLGLTHMDSSISHKNTQPTAYTSIMGSMKVLSFIADGFYIYYPMLVVILCIATYFSLGTRCLNLLGFQQ    491 - 560
FMGDDDMTSDLVNEGKELIRKEKRKRQRQEEGENRRREWKERYGHNREDSTRNRNIHTDPKESNFSDVNT    561 - 630
NRSAFKYTRANNRTERDRIELLQDAEPLDFNAETFTDDPLESESGRYQPGGRYLSMSRSDIFNDV         631 - 695
//

Text Mined References (7)

PMID Year Title