Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.40
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
non-small cell lung carcinoma 317 9.4e-26
lung carcinoma 2843 5.3e-17
lung adenocarcinoma 2716 6.2e-08
osteosarcoma 7950 4.2e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Ileocolitis 5 4.853 2.4

Expression

  Differential Expression (4)

Disease log2 FC p
lung adenocarcinoma -1.200 6.2e-08
lung carcinoma -2.000 5.3e-17
non-small cell lung carcinoma -1.400 9.4e-26
osteosarcoma 1.132 4.2e-06

Gene RIF (4)

AA Sequence

MLWALWPRWLADKMLPLLGAVLLQKREKRGPLWRHWRRETYPYYDLQVKVLRATNIRGTDLLSKADCYVQ      1 - 70
LWLPTASPSPAQTRIVANCSDPEWNETFHYQIHGAVKNVLELTLYDKDILGSDQLSLLLFDLRSLKCGQP     71 - 140
HKHTFPLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAHPCLRIQGTLRGDGTAPREEYGSRQLQLAVP    141 - 210
GAYEKPQLLPLQPPTEPGLPPTFTFHVNPVLSSRLHVELMELLAAVQSGPSAELEAQTSKLGEGGILLSS    211 - 280
LPLGQEEQCSVALGEGQEVALSMKVEMSSGDLDLRLGFDLSDGEQEFLDRRKQVVSKALQQVLGLSEALD    281 - 350
SGQVPVVAVLGSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE    351 - 420
RAQVHVCSSKMGALSTERLQYYTQELGVRERSGHSVSLIDLWGLLVEYLLYQEENPAKLSDQQEAVRQGQ    421 - 490
NPYPIYTSVNVRTNLSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELFMGRLLQLQPEPRICYLQGMW    491 - 560
GSAFATSLDEIFLKTAGSGLSFLEWYRGSVNITDDCQKPQLHNPSRLRTRLLTPQGPFSQAVLDIFTSRF    561 - 630
TSAQSFNFTRGLCLHKDYVAGREFVAWKDTHPDAFPNQLTPMRDCLYLVDGGFAINSPFPLALLPQRAVD    631 - 700
LILSFDYSLEAPFEVLKMTEKYCLDRGIPFPSIEVGPEDMEEARECYLFAKAEDPRSPIVLHFPLVNRTF    701 - 770
RTHLAPGVERQTAEEKAFGDFVINRPDTPYGMMNFTYEPQDFYRLVALSRYNVLNNVETLKCALQLALDR    771 - 840
HQARERAGA                                                                 841 - 849
//

Text Mined References (8)

PMID Year Title