Property Summary

NCBI Gene PubMed Count 21
PubMed Score 27.57
PubTator Score 6.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

AA Sequence

MTWRAAASTCAALLILLWALTTEGDLKVEMMAGGTQITPLNDNVTIFCNIFYSQPLNITSMGITWFWKSL      1 - 70
TFDKEVKVFEFFGDHQEAFRPGAIVSPWRLKSGDASLRLPGIQLEEAGEYRCEVVVTPLKAQGTVQLEVV     71 - 140
ASPASRLLLDQVGMKENEDKYMCESSGFYPEAINITWEKQTQKFPHPIEISEDVITGPTIKNMDGTFNVT    141 - 210
SCLKLNSSQEDPGTVYQCVVRHASLHTPLRSNFTLTAARHSLSETEKTDNFSIHWWPISFIGVGLVLLIV    211 - 280
LIPWKKICNKSSSAYTPLKCILKHWNSFDTQTLKKEHLIFFCTRAWPSYQLQDGEAWPPEGSVNINTIQQ    281 - 350
LDVFCRQEGKWSEVPYVQAFFALRDNPDLCQCCRIDPALLTVTSGKSIDDNSTKSEKQTPREHSDAVPDA    351 - 420
PILPVSPIWEPPPATTSTTPVLSSQPPTLLLPLQ                                        421 - 454
//

Text Mined References (24)

PMID Year Title