Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.40
PubTator Score 0.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer -1.700 1.5e-18
diabetes mellitus -1.300 3.9e-03
interstitial cystitis -1.400 8.2e-04
lung adenocarcinoma -1.300 2.2e-16
lung carcinoma -1.500 1.7e-13
mucosa-associated lymphoid tissue lympho... 1.732 4.7e-03
nasopharyngeal carcinoma -1.500 3.5e-07
osteosarcoma -1.351 9.2e-03
ovarian cancer -1.100 1.0e-07
pancreatic ductal adenocarcinoma liver m... -1.129 1.0e-03
pituitary cancer 1.300 3.3e-03
spina bifida -2.362 4.1e-02
urothelial carcinoma -2.100 5.5e-06

AA Sequence

MDVGFSRTTVQTLSRSHCKNIKQKISQWEGRANGISNPEKWCPKDFGVRYNCHQEIRLKKNPIAERKSKN      1 - 70
LDVTSRENVGLDINENTKSHDQSENENKKHEYDDTHFFKNESESNWVCSRVKEIESCKEDVLDPETSLPP     71 - 140
GNFYTSQILWKKIEALPPDKLLNLALEHCDSSEKELNFRVLDSSYGITKSLENIYSEPEGQECGPSINPL    141 - 210
PKPRRTFRYLSESGVTPYKERNCDKKYCENNSCAQSSLASSQEPEPKKYGGKIRGRSKRKSFEFEDIQHF    211 - 280
RNRNSQTIREELGRNSGSALYYTQSEDNIYEDIIYPTKENPYEDIPVQPLPMWRSPSAWKLPPAKSAFKA    281 - 350
PKLPPKPQFLHRKTMEVKNSQAYLRSKLTKDTTLPVTLTEWKLFRAGEVANTKRKNLPRLVLKIDDIFES    351 - 420
KRGKKKVKLHSYTGKELPPTKGETSGNESDAEYLPKNRHKRLAQLQPSSKRNPHYQTLERDLIELQEQQL    421 - 490
FELFVVVSLQKKPSGISYIPQVIQQFPGKDDHGYKQSKDMEERLKVIPKFCFPDSKDWMPTSELKSETFS    491 - 560
FVLTGEDGSRWFGYCKKLLPVGKGKRLPEVYCMVSRLGCFNLFSKILDEVEKRREMSPALVYPFMRSVME    561 - 630
APFPAPGRTITVKSYLPGAGDESIELCRPLDSRLEHVDFKCLFKCLSVCHLIRVCASLLLERRVIFVANS    631 - 700
LSTLSKCGHAVVATLYPFTWQHTYIPVLPASMIDIVCSPTPFLIGILSCSLPQLQDLPIEEVLIVDLCAD    701 - 770
KFLQEVSDEDEILPPKLQAALMQILEERNEILTQEQNFSQDVTLNSLVSEAFVRFFVELVGHYSLNMTVT    771 - 840
ERGERVFQREPFRKSHTSRSVRHFLDLFMETQMFAGFIQDRELRKSGVKGLFEIRAIQYLETIPESEPSG    841 - 910
MNRILRSLGSKMKFLQKK                                                        911 - 928
//

Text Mined References (9)

PMID Year Title