Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.79
PubTator Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Visceral leishmaniasis 13 4.032 2.0
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 0.000

AA Sequence

MRPDDINPRTGLVVALVSVFLVFGFMFTVSGMKGETLGNIPLLAIGPAICLPGIAAIALARKTEGCTKWP      1 - 70
ENELLWVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQSQGEVSVASSINSPTP     71 - 140
TEEGECQSLVQNGHQEETSRYLDGYCPSGSSLTYSALDVKCSARDRSECPEPEDSIFFVPQDSIIVCSYK    141 - 210
QNSPYDRYCCYINQIQGRWDHETIV                                                 211 - 235
//

Text Mined References (4)

PMID Year Title
22658931 2012 A genome-wide association study of host genetic determinants of the antibody response to Anthrax Vaccine Adsorbed.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.