Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.79
PubTator Score 0.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 3.1e-07
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Visceral leishmaniasis 14 4.046 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.400 3.1e-07

AA Sequence

MRPDDINPRTGLVVALVSVFLVFGFMFTVSGMKGETLGNIPLLAIGPAICLPGIAAIALARKTEGCTKWP      1 - 70
ENELLWVRKLPCFRKPKDKEVVELLRTPSDLESGKGSSDELAKKAGLRGKPPPQSQGEVSVASSINSPTP     71 - 140
TEEGECQSLVQNGHQEETSRYLDGYCPSGSSLTYSALDVKCSARDRSECPEPEDSIFFVPQDSIIVCSYK    141 - 210
QNSPYDRYCCYINQIQGRWDHETIV                                                 211 - 235
//

Text Mined References (4)

PMID Year Title