Property Summary

NCBI Gene PubMed Count 4
PubMed Score 309.34
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Synonym

Accession Q68D20 B4DK88 Q764P1
Symbols PMS2P13

Gene

AA Sequence

MHAADLEKPMVEKQDQSPSLRTGEEKRDVSISRLREAFSLRHTTENKPHSPKTPEPRRSPLGQKRGMSSS      1 - 70
STSDAISDRGVLRPQKEAVSSSQGPSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSECVASTPGD     71 - 140
RGSQEHVDSQEKAPETDDSFSDVDCHSNQEDTGCKFQVLPQPTNLTSPNTKVF                     141 - 193
//

Text Mined References (7)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17253626 2007 Extensive gene conversion at the PMS2 DNA mismatch repair locus.
15256438 2004 Mismatch repair gene PMS2: disease-causing germline mutations are frequent in patients whose tumors stain negative for PMS2 protein, but paralogous genes obscure mutation detection and interpretation.
15077197 2004 Novel PMS2 pseudogenes can conceal recessive mutations causing a distinctive childhood cancer syndrome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.