Property Summary

NCBI Gene PubMed Count 4
PubMed Score 339.47
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
ovarian cancer 8520 0.0 5.0
Disease Target Count Z-score Confidence
Lynch syndrome 35 7.723 3.9

Synonym

Accession Q68D20 B4DK88 Q764P1
Symbols PMS2P13

Gene

AA Sequence

MHAADLEKPMVEKQDQSPSLRTGEEKRDVSISRLREAFSLRHTTENKPHSPKTPEPRRSPLGQKRGMSSS      1 - 70
STSDAISDRGVLRPQKEAVSSSQGPSDPTDRAEVEKDSGHGSTSVDSEGFSIPDTGSHCSSECVASTPGD     71 - 140
RGSQEHVDSQEKAPETDDSFSDVDCHSNQEDTGCKFQVLPQPTNLTSPNTKVF                     141 - 193
//

Text Mined References (7)

PMID Year Title