Property Summary

NCBI Gene PubMed Count 8
Grant Count 13
R01 Count 10
Funding $1,470,463.1
PubMed Score 4.82
PubTator Score 0.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.773 0.000
spina bifida -1.115 0.036
acute myeloid leukemia 1.300 0.005

Gene RIF (3)

PMID Text
26722495 there may be a racial/ethnic- and/or sex-specific association between the SPTY2D1 rs17579600 single nucleotide polymorphism and serum lipid parameters in some ethnic groups.
25755761 These findings suggest that the association between the SPTY2D1 rs7934205 SNP and serum lipid levels might have ethnic- and/or sex-specificity.
23378026 Spt2 is a novel histone chaperone with a separate DNA-binding domain that facilitates ribosomal DNA transcription through chromatin remodeling during transcription.

AA Sequence

MDFREILMIASKGQGVNNVPKRYSLAVGPPKKDPKVKGVQSAAVQAFLKRKEEELRRKALEEKRRKEELV      1 - 70
KKRIELKHDKKARAMAKRTKDNFHGYNGIPIEEKSKKRQATESHTSQGTDREYEMEEENEFLEYNHAESE     71 - 140
QEYEEEQEPPKVESKPKVPLKSAPPPMNFTDLLRLAEKKQFEPVEIKVVKKSEERPMTAEELREREFLER    141 - 210
KHRRKKLETDGKLPPTVSKKAPSQKESVGTKLSKGSGDRHPSSKGMPLPHAEKKSRPSMANEKHLALSSS    211 - 280
KSMPGERIKAGSGNSSQPSLREGHDKPVFNGAGKPHSSTSSPSVPKTSASRTQKSAVEHKAKKSLSHPSH    281 - 350
SRPGPMVTPHNKAKSPGVRQPGSSSSSAPGQPSTGVARPTVSSGPVPRRQNGSSSSGPERSISGSKKPTN    351 - 420
DSNPSRRTVSGTCGPGQPASSSGGPGRPISGSVSSARPLGSSRGPGRPVSSPHELRRPVSGLGPPGRSVS    421 - 490
GPGRSISGSIPAGRTVSNSVPGRPVSSLGPGQTVSSSGPTIKPKCTVVSETISSKNIISRSSNGQMNGMK    491 - 560
PPLSGYRAAQGPQRLPFPTGYKRQREYEEEDDDDDEYDSEMEDFIEDEGEPQEEISKHIREIFGYDRKKY    561 - 630
KDESDYALRYMESSWKEQQKEEAKSLRLGMQEDLEEMRREEEEMQRRRAKKLKRR                   631 - 685
//

Text Mined References (15)

PMID Year Title
26722495 2015 Association of the SPT2 chromatin protein domain containing 1 gene rs17579600 polymorphism and serum lipid traits.
26109053 2015 Structure-function studies of histone H3/H4 tetramer maintenance during transcription by chaperone Spt2.
25755761 2015 Sex-specific association of the SPTY2D1 rs7934205 polymorphism and serum lipid levels.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23378026 2013 Vertebrate Spt2 is a novel nucleolar histone chaperone that assists in ribosomal DNA transcription.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...