Property Summary

NCBI Gene PubMed Count 9
PubMed Score 1.02
PubTator Score 0.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
active Crohn's disease 1.454 1.6e-02
adrenocortical carcinoma 1.162 1.9e-02
atypical teratoid / rhabdoid tumor 1.100 2.4e-02
group 4 medulloblastoma 1.300 2.6e-05
lung adenocarcinoma 1.200 1.6e-09
lung carcinoma -1.700 2.5e-15
osteosarcoma -3.117 4.6e-06
pancreatic cancer 1.100 6.0e-04
posterior fossa group B ependymoma 1.700 3.4e-04

AA Sequence

MEANHCSLGVYPSYPDLVIDVGEVTLGEENRKKLQKTQRDQERARVIRAACALLNSGGGVIQMEMANRDE      1 - 70
RPTEMGLDLEESLRKLIQYPYLQAFFETKQHGRCFYIFVKSWSGDPFLKDGSFNSRICSLSSSLYCRSGT     71 - 140
SVLHMNSRQAFDFLKTKERQSKYNLINEGSPPSKIMKAVYQNISESNPAYEVFQTDTIEYGEILSFPESP    141 - 210
SIEFKQFSTKHIQQYVENIIPEYISAFANTEGGYLFIGVDDKSRKVLGCAKEQVDPDSLKNVIARAISKL    211 - 280
PIVHFCSSKPRVEYSTKIVEVFCGKELYGYLCVIKVKAFCCVVFSEAPKSWMVREKYIRPLTTEEWVEKM    281 - 350
MDADPEFPPDFAEAFESQLSLSDSPSLCRPVYSKKGLEHKADLQQHLFPVPPGHLECTPESLWKELSLQH    351 - 420
EGLKELIHKQMRPFSQGIVILSRSWAVDLNLQEKPGVICDALLIAQNSTPILYTILREQDAEGQDYCTRT    421 - 490
AFTLKQKLVNMGGYTGKVCVRAKVLCLSPESSAEALEAAVSPMDYPASYSLAGTQHMEALLQSLVIVLLG    491 - 560
FRSLLSDQLGCEVLNLLTAQQYEIFSRSLRKNRELFVHGLPGSGKTIMAMKIMEKIRNVFHCEAHRILYV    561 - 630
CENQPLRNFISDRNICRAETRETFLREKFEHIQHIVIDEAQNFRTEDGDWYRKAKTITQREKDCPGVLWI    631 - 700
FLDYFQTSHLGHSGLPPLSAQYPREELTRVVRNADEIAEYIQQEMQLIIENPPINIPHGYLAILSEAKWV    701 - 770
PGVPGNTKIIKNFTLEQIVTYVADTCRCFFERGYSPKDVAVLVSTVTEVEQYQSKLLKAMRKKMVVQLSD    771 - 840
ACDMLGVHIVLDSVRRFSGLERSIVFGIHPRTADPAILPNILICLASRAKQHLYIFL                 841 - 897
//

Text Mined References (10)

PMID Year Title