Property Summary

NCBI Gene PubMed Count 25
PubMed Score 115.13
PubTator Score 27.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute quadriplegic myopathy 1.520 5.9e-05
astrocytoma 1.800 1.4e-03
autosomal dominant Emery-Dreifuss muscul... 1.292 8.7e-03
dermatomyositis 1.100 2.5e-03
Duchenne muscular dystrophy 1.128 1.6e-05
esophageal adenocarcinoma 1.500 2.3e-02
group 3 medulloblastoma -1.800 1.8e-04
invasive ductal carcinoma 2.261 2.6e-05
juvenile dermatomyositis 1.467 1.1e-11
medulloblastoma, large-cell -3.400 3.3e-07
non-small cell lung cancer -1.058 3.0e-09
ovarian cancer -1.800 9.4e-06
Pick disease 1.100 7.3e-03
ulcerative colitis -1.200 1.2e-04
Waldenstrons macroglobulinemia 1.894 1.4e-02

Gene RIF (10)

AA Sequence

MEEGHGLDLTYITERIIAVSFPAGCSEESYLHNLQEVTRMLKSKHGDNYLVLNLSEKRYDLTKLNPKIMD      1 - 70
VGWPELHAPPLDKMCTICKAQESWLNSNLQHVVVIHCRGGKGRIGVVISSYMHFTNVSASADQALDRFAM     71 - 140
KKFYDDKVSALMQPSQKRYVQFLSGLLSGSVKMNASPLFLHFVILHGTPNFDTGGVCRPFLKLYQAMQPV    141 - 210
YTSGIYNVGPENPSRICIVIEPAQLLKGDVMVKCYHKKYRSATRDVIFRLQFHTGAVQGYGLVFGKEDLD    211 - 280
NASKDDRFPDYGKVELVFSATPEKIQGSEHLYNDHGVIVDYNTTDPLIRWDSYENLSADGEVLHTQGPVD    281 - 350
GSLYAKVRKKSSSDPGIPGGPQAIPATNSPDHSDHTLSVSSDSGHSTASARTDKTEERLAPGTRRGLSAQ    351 - 420
EKAELDQLLSGFGLEDPGSSLKEMTDARSKYSGTRHVVPAQVHVNGDAALKDRETDILDDEMPHHDLHSV    421 - 490
DSLGTLSSSEGPQSAHLGPFTCHKSSQNSLLSDGFGSNVGEDPQGTLVPDLGLGMDGPYERERTFGSREP    491 - 560
KQPQPLLRKPSVSAQMQAYGQSSYSTQTWVRQQQMVVAHQYSFAPDGEARLVSRCPADNPGLVQAQPRVP    561 - 630
LTPTRGTSSRVAVQRGVGSGPHPPDTQQPSPSKAFKPRFPGDQVVNGAGPELSTGPSPGSPTLDIDQSIE    631 - 700
QLNRLILELDPTFEPIPTHMNALGSQANGSVSPDSVGGGLRASSRLPDTGEGPSRATGRQGSSAEQPLGG    701 - 770
RLRKLSLGQYDNDAGGQLPFSKCAWGKAGVDYAPNLPPFPSPADVKETMTPGYPQDLDIIDGRILSSKES    771 - 840
MCSTPAFPVSPETPYVKTALRHPPFSPPEPPLSSPASQHKGGREPRSCPETLTHAVGMSESPIGPKSTML    841 - 910
RADASSTPSFQQAFASSCTISSNGPGQRRESSSSAERQWVESSPKPMVSLLGSGRPTGSPLSAEFSGTRK    911 - 980
DSPVLSCFPPSELQAPFHSHELSLAEPPDSLAPPSSQAFLGFGTAPVGSGLPPEEDLGALLANSHGASPT    981 - 1050
PSIPLTATGAADNGFLSHNFLTVAPGHSSHHSPGLQGQGVTLPGQPPLPEKKRASEGDRSLGSVSPSSSG   1051 - 1120
FSSPHSGSTISIPFPNVLPDFSKASEAASPLPDSPGDKLVIVKFVQDTSKFWYKADISREQAIAMLKDKE   1121 - 1190
PGSFIVRDSHSFRGAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCSNEPYFGSL   1191 - 1260
TALVCQHSITPLALPCKLLIPERDPLEEIAESSPQTAANSAAELLKQGAACNVWYLNSVEMESLTGHQAI   1261 - 1330
QKALSITLVQEPPPVSTVVHFKVSAQGITLTDNQRKLFFRRHYPVNSVIFCALDPQDRKWIKDGPSSKVF   1331 - 1400
GFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIGSPKKV                            1401 - 1445
//

Text Mined References (37)

PMID Year Title