Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary


No data available


AA Sequence

LRDLEFSNVDVLQQTPPCSAEVPSDPDKAAFHERDSDILK                                  841 - 880

Text Mined References (2)

PMID Year Title