Property Summary

NCBI Gene PubMed Count 25
Grant Count 10
Funding $398,336.68
PubMed Score 14.64
PubTator Score 223.18

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
26716708 Arid2 role in genome-wide transcriptional regulation by SWI/SNF complexes.
26238514 This is the first report of mutations in ARID2 associated with developmental delay and intellectual disabilities .
25701229 loss of ARID2 protein expression may be associated with recurrence of hepatocellular carcinoma
25636086 The subsequent validation study on 68 LCBs identified recurrent mutations in TERT promoter, chromatin regulators (BAP1, PBRM1 and ARID2), a synapse organization gene (PCLO), IDH genes and KRAS.
24382590 Mutations in ARID2 gene is associated with microsatellite unstable colorectal cancer.
23047306 Recurrent inactivating mutations of ARID2 is associated with non-small cell lung carcinoma.
22140357 A PBAF-specific component BAF200 is required for HIV-1 Tat-mediated activation of HIV LTR
22095441 we summarize the current knowledge about the relevance of ARID2 in Hepatocellular carcinoma and the implication in future patient care
21822264 18.2% of individuals with HCV-associated HCC in the United States and Europe harbored ARID2 inactivation mutations, suggesting that ARID2 is a tumor suppressor gene that is relatively commonly mutated in this tumor subtype.
20599239 A PBAF-specific component BAF200 is required for HIV-1 Tat-mediated activation of HIV LTR
More...

AA Sequence

MANSTGKAPPDERRKGLAFLDELRQFHHSRGSPFKKIPAVGGKELDLHGLYTRVTTLGGFAKVSEKNQWG      1 - 70
EIVEEFNFPRSCSNAAFALKQYYLRYLEKYEKVHHFGEDDDEVPPGNPKPQLPIGAIPSSYNYQQHSVSD     71 - 140
YLRQSYGLSMDFNSPNDYNKLVLSLLSGLPNEVDFAINVCTLLSNESKHVMQLEKDPKIITLLLANAGVF    141 - 210
DDTLGSFSTVFGEEWKEKTDRDFVKFWKDIVDDNEVRDLISDRNKSHEGTSGEWIWESLFHPPRKLGIND    211 - 280
IEGQRVLQIAVILRNLSFEEGNVKLLAANRTCLRFLLLSAHSHFISLRQLGLDTLGNIAAELLLDPVDFK    281 - 350
TTHLMFHTVTKCLMSRDRFLKMRGMEILGNLCKAEDNGVLICEYVDQDSYREIICHLTLPDVLLVISTLE    351 - 420
VLYMLTEMGDVACTKIAKVEKSIDMLVCLVSMDIQMFGPDALAAVKLIEHPSSSHQMLSEIRPQAIEQVQ    421 - 490
TQTHVASAPASRAVVAQHVAPPPGIVEIDSEKFACQWLNAHFEVNPDCSVSRAEMYSEYLSTCSKLARGG    491 - 560
ILTSTGFYKCLRTVFPNHTVKRVEDSSSNGQAHIHVVGVKRRAIPLPIQMYYQQQPVSTSVVRVDSVPDV    561 - 630
SPAPSPAGIPHGSQTIGNHFQRTPVANQSSNLTATQMSFPVQGVHTVAQTVSRIPQNPSPHTHQQQNAPV    631 - 700
TVIQSKAPIPCEVVKATVIQNSIPQTGVPVSIAVGGGPPQSSVVQNHSTGPQPVTVVNSQTLLHHPSVIP    701 - 770
QQSPLHTVVPGQIPSGTPVTVIQQAVPQSHMFGRVQNIPACTSTVSQGQQLITTSPQPVQTSSQQTSAGS    771 - 840
QSQDTVIIAPPQYVTTSASNIVSATSVQNFQVATGQMVTIAGVPSPQASRVGFQNIAPKPLPSQQVSSTV    841 - 910
VQQPIQQPQQPTQQSVVIVSQPAQQGQTYAPAIHQIVLANPAALPAGQTVQLTGQPNITPSSSPSPVPAT    911 - 980
NNQVPTAMSSSSTPQSQGPPPTVSQMLSVKRQQQQQHSPAPPPQQVQVQVQQPQQVQMQVQPQQSNAGVG    981 - 1050
QPASGESSLIKQLLLPKRGPSTPGGKLILPAPQIPPPNNARAPSPQVVYQVASNQAAGFGVQGQTPAQQL   1051 - 1120
LVGQQNVQLVPSAMPPSGGVQTVPISNLQILPGPLISNSPATIFQGTSGNQVTITVVPNTSFAPATVSQG   1121 - 1190
NATQLIAPAGITMSGTQTGVGLPVQTLPATQASPAGQSSCTTATPPFKGDKIICQKEEEAKEATGLHVHE   1191 - 1260
RKIEVMENPSCRRGATNTSNGDTKENEMHVGSLLNGRKYSDSSLPPSNSGKIQSETNQCSLISNGPSLEL   1261 - 1330
GENGASGKQNSEQIDMQDIKSDLRKPLVNGICDFDKGDGSHLSKNIPNHKTSNHVGNGEISPMEPQGTLD   1331 - 1400
ITQQDTAKGDQLERISNGPVLTLGGSSVSSIQEASNAATQQFSGTDLLNGPLASSLNSDVPQQRPSVVVS   1401 - 1470
PHSTTSVIQGHQIIAVPDSGSKVSHSPALSSDVRSTNGTAECKTVKRPAEDTDRETVAGIPNKVGVRIVT   1471 - 1540
ISDPNNAGCSATMVAVPAGADPSTVAKVAIESAVQQKQQHPPTYVQNVVPQNTPMPPSPAVQVQGQPNSS   1541 - 1610
QPSPFSGSSQPGDPMRKPGQNFMCLWQSCKKWFQTPSQVFYHAATEHGGKDVYPGQCLWEGCEPFQRQRF   1611 - 1680
SFITHLQDKHCSKDALLAGLKQDEPGQAGSQKSSTKQPTVGGTSSTPRAQKAIVNHPSAALMALRRGSRN   1681 - 1750
LVFRDFTDEKEGPITKHIRLTAALILKNIGKYSECGRRLLKRHENNLSVLAISNMEASSTLAKCLYELNF   1751 - 1820
TVQSKEQEKDSEMLQ                                                          1821 - 1835
//

Text Mined References (31)

PMID Year Title
26716708 2015 Genome-Wide Transcriptional Regulation Mediated by Biochemically Distinct SWI/SNF Complexes.
26238514 2015 Mutations in ARID2 are associated with intellectual disabilities.
26169693 2015 miR-208-3p promotes hepatocellular carcinoma cell proliferation and invasion through regulating ARID2 expression.
25701229 2015 AT-rich interactive domain 2, p110?, p53, and ?-catenin protein expression in hepatocellular carcinoma and clinicopathologic implications.
25636086 2015 Whole-genome mutational landscape of liver cancers displaying biliary phenotype reveals hepatitis impact and molecular diversity.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24382590 2014 Exome sequencing reveals frequent inactivating mutations in ARID1A, ARID1B, ARID2 and ARID4A in microsatellite unstable colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23047306 2013 Recurrent inactivating mutations of ARID2 in non-small cell lung carcinoma.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
More...