Property Summary

NCBI Gene PubMed Count 21
PubMed Score 29.34
PubTator Score 24.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Mucopolysaccharidosis III 7 0.0 5.0
RETINITIS PIGMENTOSA 73 2 0.0 0.0
Disease Target Count
MPS III C 1
Disease Target Count P-value
osteosarcoma 7950 1.4e-06
tuberculosis 2010 5.5e-06
ovarian cancer 8520 6.1e-06
psoriasis 6694 9.8e-04
astrocytoma 1146 2.0e-03
lung cancer 4740 1.2e-02
subependymal giant cell astrocytoma 2287 4.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Mucopolysaccharidosis 26 6.341 3.2
Disease Target Count Z-score Confidence
Kluver-Bucy syndrome 6 4.518 2.3
D-2-hydroxyglutaric aciduria 9 4.0 2.0

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.500 2.0e-03
lung cancer -1.500 1.2e-02
osteosarcoma 2.701 1.4e-06
ovarian cancer -1.200 6.1e-06
psoriasis -1.200 9.8e-04
subependymal giant cell astrocytoma 1.085 4.9e-02
tuberculosis -1.100 5.5e-06

Gene RIF (13)

AA Sequence

MTGARASAAEQRRAGRSGQARAAERAAGMSGAGRALAALLLAASVLSAALLAPGGSSGRDAQAAPPRDLD      1 - 70
KKRHAELKMDQALLLIHNELLWTNLTVYWKSECCYHCLFQVLVNVPQSPKAGKPSAAAASVSTQHGSILQ     71 - 140
LNDTLEEKEVCRLEYRFGEFGNYSLLVKNIHNGVSEIACDLAVNEDPVDSNLPVSIAFLIGLAVIIVISF    141 - 210
LRLLLSLDDFNNWISKAISSRETDRLINSELGSPSRTDPLDGDVQPATWRLSALPPRLRSVDTFRGIALI    211 - 280
LMVFVNYGGGKYWYFKHASWNGLTVADLVFPWFVFIMGSSIFLSMTSILQRGCSKFRLLGKIAWRSFLLI    281 - 350
CIGIIIVNPNYCLGPLSWDKVRIPGVLQRLGVTYFVVAVLELLFAKPVPEHCASERSCLSLRDITSSWPQ    351 - 420
WLLILVLEGLWLGLTFLLPVPGCPTGYLGPGGIGDFGKYPNCTGGAAGYIDRLLLGDDHLYQHPSSAVLY    421 - 490
HTEVAYDPEGILGTINSIVMAFLGVQAGKILLYYKARTKDILIRFTAWCCILGLISVALTKVSENEGFIP    491 - 560
VNKNLWSLSYVTTLSSFAFFILLVLYPVVDVKGLWTGTPFFYPGMNSILVYVGHEVFENYFPFQWKLKDN    561 - 630
QSHKEHLTQNIVATALWVLIAYILYRKKIFWKI                                         631 - 663
//

Text Mined References (27)

PMID Year Title