Property Summary

NCBI Gene PubMed Count 8
Grant Count 3
R01 Count 2
Funding $178,096.25
PubMed Score 1.00
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
astrocytic glioma -2.700 0.004
ependymoma -2.100 0.030
oligodendroglioma -2.300 0.012
osteosarcoma -1.471 0.000
group 4 medulloblastoma -2.100 0.000
atypical teratoid / rhabdoid tumor -1.200 0.003
glioblastoma -1.300 0.006
medulloblastoma, large-cell -2.100 0.000
primitive neuroectodermal tumor 1.300 0.000
lung cancer 2.600 0.002
non primary Sjogren syndrome sicca 1.300 0.005
lung adenocarcinoma -1.157 0.000
ovarian cancer 1.600 0.000

Synonym

Accession Q68CL5 B4DIX2 K7EIJ9 Q4KN59 Q8WTU3 Q96BT9 Q9Y435 PGs2
Symbols L17
PGs2
C18orf10
HMFN0601

Gene

AA Sequence

MEEEASSPGLGCSKPHLEKLTLGITRILESSPGVTEVTIIEKPPAERHMISSWEQKNNCVMPEDVKNFYL      1 - 70
MTNGFHMTWSVKLDEHIIPLGSMAINSISKLTQLTQSSMYSLPNAPTLADLEDDTHEASDDQPEKPHFDS     71 - 140
RSVIFELDSCNGSGKVCLVYKSGKPALAEDTEIWFLDRALYWHFLTDTFTAYYRLLITHLGLPQWQYAFT    141 - 210
SYGISPQAKQWFSMYKPITYNTNLLTEETDSFVNKLDPSKVFKSKNKIVIPKKKGPVQPAGGQKGPSGPS    211 - 280
GPSTSSTSKSSSGSGNPTRK                                                      281 - 300
//

Text Mined References (11)

PMID Year Title
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16341674 2005 Transcriptome analysis of human gastric cancer.
16177791 2005 DNA sequence and analysis of human chromosome 18.
15890843 2005 Tubulin polyglutamylase enzymes are members of the TTL domain protein family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15334068 2004 Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer.
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...