Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.96
PubTator Score 7.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.756 0.001

Synonym

Accession Q68CK6 Q86YT1
Symbols HXMA
ACSM2
HYST1046

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
20679960 Observational study of gene-disease association. (HuGE Navigator)
16521160 Observational study of gene-disease association. (HuGE Navigator)
16521160 results suggest an involvement of the medium-chain acyl-CoA synthetase 2 (MACS2) Leu513Ser polymorphism in the development of the metabolic syndrome in Caucasian population

AA Sequence

MHWLRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWADMEKAGKRLPSPALW      1 - 70
WVNGKGKELMWNFRELSENSQQAANILSGACGLQRGDRVAVMLPRVPEWWLVILGCIRAGLIFMPGTIQM     71 - 140
KSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKSCDGWLNFKKLLNEASTTHHCVET    141 - 210
GSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWTGLQASDIMWTISDTGWILNILGSLLESWTLG    211 - 280
ACTFVHLLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQQDLSSYKFPHLQNCLAGGESLLPETLENWR    281 - 350
AQTGLDIREFYGQTETGLTCMVSKTMKIKPGYMGTAASCYDVQVIDDKGNVLPPGTEGDIGIRVKPIRPI    351 - 420
GIFSGYVENPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADDIINSSGYRIGPSEVENALMKHPAVVE    421 - 490
TAVISSPDPVRGEVVKAFVILASQFLSHDPEQLTKELQQHVKSVTAPYKYPRKIEFVLNLPKTVTGKIQR    491 - 560
TKLRDKEWKMSGKARAQ                                                         561 - 577
//

Text Mined References (13)

PMID Year Title
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
19634011 2009 Comparative analyses of disease risk genes belonging to the acyl-CoA synthetase medium-chain (ACSM) family in human liver and cell lines.
16521160 2006 The L513S polymorphism in medium-chain acyl-CoA synthetase 2 (MACS2) is associated with risk factors of the metabolic syndrome in a Caucasian study population.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
15122652 2004 Characterization of triacsin C inhibition of short-, medium-, and long-chain fatty acid: CoA ligases of human liver.
12616642 2003 Isolation, sequencing, and expression of a cDNA for the HXM-A form of xenobiotic/medium-chain fatty acid:CoA ligase from human liver mitochondria.
11415461 2001 Characterization of the reaction mechanism for the XL-I form of bovine liver xenobiotic/medium-chain fatty acid:CoA ligase.
More...