Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.96
PubTator Score 7.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
pancreatic ductal adenocarcinoma liver metastasis 1795 5.74984436663627E-4

Expression

  Differential Expression (1)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.756 0.001

Synonym

Accession Q68CK6 Q86YT1
Symbols HXMA
ACSM2
HYST1046

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
20679960 Observational study of gene-disease association. (HuGE Navigator)
16521160 Observational study of gene-disease association. (HuGE Navigator)
16521160 results suggest an involvement of the medium-chain acyl-CoA synthetase 2 (MACS2) Leu513Ser polymorphism in the development of the metabolic syndrome in Caucasian population

AA Sequence

MHWLRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWADMEKAGKRLPSPALW      1 - 70
WVNGKGKELMWNFRELSENSQQAANILSGACGLQRGDRVAVMLPRVPEWWLVILGCIRAGLIFMPGTIQM     71 - 140
KSTDILYRLQMSKAKAIVAGDEVIQEVDTVASECPSLRIKLLVSEKSCDGWLNFKKLLNEASTTHHCVET    141 - 210
GSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGWTGLQASDIMWTISDTGWILNILGSLLESWTLG    211 - 280
ACTFVHLLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQQDLSSYKFPHLQNCLAGGESLLPETLENWR    281 - 350
AQTGLDIREFYGQTETGLTCMVSKTMKIKPGYMGTAASCYDVQVIDDKGNVLPPGTEGDIGIRVKPIRPI    351 - 420
GIFSGYVENPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADDIINSSGYRIGPSEVENALMKHPAVVE    421 - 490
TAVISSPDPVRGEVVKAFVILASQFLSHDPEQLTKELQQHVKSVTAPYKYPRKIEFVLNLPKTVTGKIQR    491 - 560
TKLRDKEWKMSGKARAQ                                                         561 - 577
//

Text Mined References (13)

PMID Year Title
24625756 2014 Genetic determinants influencing human serum metabolome among African Americans.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
20679960 2010 Pharmacogenetic analysis of lipid responses to rosuvastatin in Chinese patients.
19634011 2009 Comparative analyses of disease risk genes belonging to the acyl-CoA synthetase medium-chain (ACSM) family in human liver and cell lines.
16521160 2006 The L513S polymorphism in medium-chain acyl-CoA synthetase 2 (MACS2) is associated with risk factors of the metabolic syndrome in a Caucasian study population.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15221005 2004 Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas.
15122652 2004 Characterization of triacsin C inhibition of short-, medium-, and long-chain fatty acid: CoA ligases of human liver.
12616642 2003 Isolation, sequencing, and expression of a cDNA for the HXM-A form of xenobiotic/medium-chain fatty acid:CoA ligase from human liver mitochondria.
11415461 2001 Characterization of the reaction mechanism for the XL-I form of bovine liver xenobiotic/medium-chain fatty acid:CoA ligase.
More...