Property Summary

NCBI Gene PubMed Count 17
Grant Count 11
R01 Count 10
Funding $694,525.38
PubMed Score 37.03
PubTator Score 15.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Hyperlipoproteinemia Type V 4
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.600 0.009

Gene RIF (8)

PMID Text
26427795 Identify a novel pathogenic mutation in CREB3L3 gene in a family with dominant hypertriglyceridemia with a variable pattern of penetrance.
25428452 CREBH activated by HBx interacted with HBx protein, leading to a synergistic effect on the expression of AP-1 target genes and the proliferation of hepatocellular carcinoma cells and mouse primary hepatocytes.
23957007 Taken together, our results demonstrated that human APOA5 is directly regulated by CREBH via CREBHRE and provided a new insight into the role of this liver-specific bZIP transcription factor in lipoprotein metabolism and triglyceride homeostasis
22262056 Studies indicate that mutations in CREB3L3 in individuals with extreme hypertriglyceridemia.
21693703 a novel mechanism of action of activated CB1R signaling to induce hepatic gluconeogenesis via direct activation of CREBH
19679815 findings show that CREBH an endoplasmic reticulum stress-activated transcription factor, binds to and transactivates the hepcidin promoter
17875199 analysis of CREB-H trafficking into alternate pathways of ERAD and stress-regulated intramembrane proteolysis
12039695 Levels of CREB transcripts did NOT significantly differ in the thyroid adenomas and surrounding normal tissues.

AA Sequence

MNTDLAAGKMASAACSMDPIDSFELLDLLFDRQDGILRHVELGEGWGHVKDQQVLPNPDSDDFLSSILGS      1 - 70
GDSLPSSPLWSPEGSDSGISEDLPSDPQDTPPRSGPATSPAGCHPAQPGKGPCLSYHPGNSCSTTTPGPV     71 - 140
IQVPEASVTIDLEMWSPGGRICAEKPADPVDLSPRCNLTVKDLLLSGSSGDLQQHHLGASYLLRPGAGHC    141 - 210
QELVLTEDEKKLLAKEGITLPTQLPLTKYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTA    211 - 280
QNQELQRKVLHLEKQNLSLLEQLKKLQAIVVQSTSKSAQTGTCVAVLLLSFALIILPSISPFGPNKTESP    281 - 350
GDFAPVRVFSRTLHNDAASRVAADAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDN    351 - 420
ATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEAAGDEL                                 421 - 461
//

Text Mined References (24)

PMID Year Title
26427795 2015 Novel CREB3L3 Nonsense Mutation in a Family With Dominant Hypertriglyceridemia.
25428452 2015 HBx induces the proliferation of hepatocellular carcinoma cells via AP1 over-expressed as a result of ER stress.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23957007 2013 Identification and characterization of cyclic AMP response element-binding protein H response element in the human apolipoprotein A5 gene promoter.
22262056 2012 The role of CREB-H transcription factor in triglyceride metabolism.
22171320 2012 Human urinary glycoproteomics; attachment site specific analysis of N- and O-linked glycosylations by CID and ECD.
21693703 2011 Cannabinoid receptor type 1 (CB1R) signaling regulates hepatic gluconeogenesis via induction of endoplasmic reticulum-bound transcription factor cAMP-responsive element-binding protein H (CREBH) in primary hepatocytes.
20356926 2010 N-linked glycosylation is required for optimal proteolytic activation of membrane-bound transcription factor CREB-H.
20102225 2010 Identification of bZIP interaction partners of viral proteins HBZ, MEQ, BZLF1, and K-bZIP using coiled-coil arrays.
19679815 2009 ER stress controls iron metabolism through induction of hepcidin.
More...