Property Summary

NCBI Gene PubMed Count 18
PubMed Score 41.52
PubTator Score 15.36

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 9.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count
Hyperlipoproteinemia Type V 3

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.600 9.1e-03

Gene RIF (9)

AA Sequence

MNTDLAAGKMASAACSMDPIDSFELLDLLFDRQDGILRHVELGEGWGHVKDQQVLPNPDSDDFLSSILGS      1 - 70
GDSLPSSPLWSPEGSDSGISEDLPSDPQDTPPRSGPATSPAGCHPAQPGKGPCLSYHPGNSCSTTTPGPV     71 - 140
IQVPEASVTIDLEMWSPGGRICAEKPADPVDLSPRCNLTVKDLLLSGSSGDLQQHHLGASYLLRPGAGHC    141 - 210
QELVLTEDEKKLLAKEGITLPTQLPLTKYEERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTA    211 - 280
QNQELQRKVLHLEKQNLSLLEQLKKLQAIVVQSTSKSAQTGTCVAVLLLSFALIILPSISPFGPNKTESP    281 - 350
GDFAPVRVFSRTLHNDAASRVAADAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDN    351 - 420
ATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEAAGDEL                                 421 - 461
//

Text Mined References (25)

PMID Year Title