Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.53
PubTator Score 0.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
breast carcinoma 1614 3.59335453721528E-30
ependymoma 2514 5.29761026709096E-11
lung adenocarcinoma 2714 5.74689154101646E-11
psoriasis 6685 1.21299758831767E-9
malignant mesothelioma 3163 4.1139586610138E-9
ovarian cancer 8492 5.93015103894172E-9
glioblastoma 5572 3.94046857926931E-7
pediatric high grade glioma 2712 6.58112163565022E-6
lung cancer 4473 5.02530961389912E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 5.65463199515995E-5
ductal carcinoma in situ 1745 8.30109005893691E-5
invasive ductal carcinoma 2950 2.15536871656324E-4
colon cancer 1475 2.69954638269585E-4
pilocytic astrocytoma 3086 3.58169494112585E-4
cystic fibrosis 1670 6.47656291066294E-4
atypical teratoid / rhabdoid tumor 4369 0.0022486491562565
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00275206927021186
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00321482979368408
head and neck cancer 270 0.00928420743844614
Breast cancer 3099 0.0248609387717636

Expression

  Differential Expression (20)

Synonym

Accession Q68BL7 Q5JTM5 Q5JTM6 Q6UXW1 Q7Z5V3
Symbols PRO34319

Gene

PANTHER Protein Class (1)

  Ortholog (11)

Gene RIF (1)

PMID Text
22913984 Three neuronal proteins (Huntingtin interacting protein 1, neurofascin, and olfactomedin-like 2a) are novel components of podocyte major processes and their expression in glomerular crescents supports their role in crescent formation.

AA Sequence

MAAAALPPRPLLLLPLVLLLSGRPTRADSKVFGDLDQVRMTSEGSDCRCKCIMRPLSKDACSRVRSGRAR      1 - 70
VEDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQSMVDLLEGTLYSMDLMKVHA     71 - 140
YVHKVASQMNTLEESIKANLSRENEVVKDSVRHLSEQLRHYENHSAIMLGIKKELSRLGLQLLQKDAAAA    141 - 210
PATPATGTGSKAQDTARGKGKDISKYGSVQKSFADRGLPKPPKEKLLQVEKLRKESGKGSFLQPTAKPRA    211 - 280
LAQQQAVIRGFTYYKAGKQEVTEAVADNTLQGTSWLEQLPPKVEGRSNSAEPNSAEQDEAEPRSSERVDL    281 - 350
ASGTPTSIPATTTTATTTPTPTTSLLPTEPPSGPEVSSQGREASCEGTLRAVDPPVRHHSYGRHEGAWMK    351 - 420
DPAARDDRIYVTNYYYGNSLVEFRNLENFKQGRWSNMYKLPYNWIGTGHVVYQGAFYYNRAFTKNIIKYD    421 - 490
LRQRFVASWALLPDVVYEDTTPWKWRGHSDIDFAVDESGLWVIYPAVDDRDEAQPEVIVLSRLDPGDLSV    491 - 560
HRETTWKTRLRRNSYGNCFLVCGILYAVDTYNQQEGQVAYAFDTHTGTDARPQLPFLNEHAYTTQIDYNP    561 - 630
KERVLYAWDNGHQLTYTLHFVV                                                    631 - 652
//

Text Mined References (8)

PMID Year Title
23509962 2013 A genome-wide search for common SNP x SNP interactions on the risk of venous thrombosis.
22913984 2013 Neuronal proteins are novel components of podocyte major processes and their expression in glomerular crescents supports their role in crescent formation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.