Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.53
PubTator Score 0.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 2.2e-03
Breast cancer 2.800 2.5e-02
breast carcinoma -1.300 3.6e-30
colon cancer -1.900 2.7e-04
cystic fibrosis -1.217 6.5e-04
ductal carcinoma in situ -1.500 8.3e-05
ependymoma 2.300 5.3e-11
glioblastoma 1.300 3.9e-07
head and neck cancer -1.100 9.3e-03
intraductal papillary-mucinous adenoma (... -1.800 5.7e-05
intraductal papillary-mucinous carcinoma... -1.500 2.8e-03
intraductal papillary-mucinous neoplasm ... -1.500 3.2e-03
invasive ductal carcinoma -1.021 2.0e-02
lung adenocarcinoma -1.500 5.7e-11
lung cancer -1.900 5.0e-05
malignant mesothelioma 5.300 4.1e-09
ovarian cancer 2.000 5.9e-09
pediatric high grade glioma 1.300 6.6e-06
Pilocytic astrocytoma 1.100 3.6e-04
psoriasis -1.300 1.2e-09

Gene RIF (1)

AA Sequence

MAAAALPPRPLLLLPLVLLLSGRPTRADSKVFGDLDQVRMTSEGSDCRCKCIMRPLSKDACSRVRSGRAR      1 - 70
VEDFYTVETVSSGTDCRCSCTAPPSSLNPCENEWKMEKLKKQAPELLKLQSMVDLLEGTLYSMDLMKVHA     71 - 140
YVHKVASQMNTLEESIKANLSRENEVVKDSVRHLSEQLRHYENHSAIMLGIKKELSRLGLQLLQKDAAAA    141 - 210
PATPATGTGSKAQDTARGKGKDISKYGSVQKSFADRGLPKPPKEKLLQVEKLRKESGKGSFLQPTAKPRA    211 - 280
LAQQQAVIRGFTYYKAGKQEVTEAVADNTLQGTSWLEQLPPKVEGRSNSAEPNSAEQDEAEPRSSERVDL    281 - 350
ASGTPTSIPATTTTATTTPTPTTSLLPTEPPSGPEVSSQGREASCEGTLRAVDPPVRHHSYGRHEGAWMK    351 - 420
DPAARDDRIYVTNYYYGNSLVEFRNLENFKQGRWSNMYKLPYNWIGTGHVVYQGAFYYNRAFTKNIIKYD    421 - 490
LRQRFVASWALLPDVVYEDTTPWKWRGHSDIDFAVDESGLWVIYPAVDDRDEAQPEVIVLSRLDPGDLSV    491 - 560
HRETTWKTRLRRNSYGNCFLVCGILYAVDTYNQQEGQVAYAFDTHTGTDARPQLPFLNEHAYTTQIDYNP    561 - 630
KERVLYAWDNGHQLTYTLHFVV                                                    631 - 652
//

Text Mined References (8)

PMID Year Title