Property Summary

NCBI Gene PubMed Count 29
PubMed Score 46.35
PubTator Score 46.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
gastric cancer 1.200 1.6e-02
hepatocellular carcinoma 1.700 4.1e-05
pancreatic cancer 2.600 4.5e-04
psoriasis 1.500 1.7e-19
osteosarcoma -2.076 4.5e-02
adrenocortical adenoma -1.331 4.4e-04
adrenocortical carcinoma -3.176 4.5e-04
pancreatic ductal adenocarcinoma liver m... -2.096 4.7e-04
tuberculosis 1.700 1.1e-03
non-small cell lung cancer -2.439 3.3e-11
intraductal papillary-mucinous adenoma (... -3.700 2.6e-05
intraductal papillary-mucinous carcinoma... -3.000 5.5e-03
intraductal papillary-mucinous neoplasm ... -1.600 4.8e-02
lung cancer -8.100 4.5e-08
breast carcinoma -1.400 3.1e-04
diabetes mellitus -1.600 1.1e-02
Breast cancer -3.500 3.5e-02
interstitial cystitis 2.200 4.0e-05
pilocytic astrocytoma 1.500 2.7e-05
sonic hedgehog group medulloblastoma 1.300 1.7e-03
pancreatic carcinoma 2.600 4.5e-04
nasopharyngeal carcinoma -1.500 6.5e-06
lung carcinoma -4.800 3.5e-34
spina bifida -2.195 4.1e-02
mucosa-associated lymphoid tissue lympho... 1.901 6.1e-03
ductal carcinoma in situ -1.500 1.3e-03
invasive ductal carcinoma -2.000 3.2e-02
ulcerative colitis 2.800 3.2e-06
pituitary cancer -2.800 4.0e-06

Gene RIF (27)

PMID Text
26510124 Some SNPs of the STEAP4 gene altered the risk of developing a metabolic syndrome in the Han Chinese population.
25680860 These data suggest that STAMP2 is required for prostate cancer progression and thus may serve as a novel therapeutic target.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of STEAP family member 4 (STEAP4; TNFAIP9) in primary human brain microvascular endothelial cells
24643198 may interact with mitochondria [review]
23953178 Our findings revealed that STAMP2 gene polymorphisms are likely to significantly contribute to the risk of MetS in male Han Chinese population.
23553608 STEAP4 was highly induced in human adipose cells differentiated in the presence of 1,25D.
23179203 Our results show increased mRNA expression of STEAP4 and NGAL in human visceral adipose tissue in obese patients.
23134829 three polymorphisms (rs8122, rs1981529 and rs34741656) of STAMP2 gene may be not related with type 2 diabetes mellitus in Xinjiang Uygur population
23095254 STAMP2 antagonizes HBx-mediated hepatocyte dysfunction, thereby protecting hepatocytes from hepatitis B virus gene expression.
22244520 STEAP4 is expressed on monocytes and neutrophils in peripheral blood of patients with rheumatoid arthritis.
21933608 an association of the common variation rs1981529 (Gly75Asp, 224A/G) in the STEAP4 gene with obesity in Uygur general population
21849520 Decreased STAMP2 expression (mRNA and protein) might reflect visceral adipose dysfunction in subjects with obesity and type 2 diabetes.
21718614 STEAP4 genetic variations are likely to be associated with obesity-related insulin resistance in Uygur Chinese general population.
21633911 STEAP4 might potentially suppress the pathogenesis of TNFalpha-induced arthritis such as rheumatoid arthritis.
21468601 The knockdown of STEAP4 inhibits insulin-stimulated glucose transport and GLUT4 translocation via the attenuated phosphorylation of Akt, independent of the effects of EEA1.
21287516 STEAP 4 genetic polymorphisms may be associated with metabolic syndrome risk in Chinese Uygur population.
21287513 There was no association of the three polymorphisms (rs8122, rs1981529 and rs34741656) in the STAMP2 gene with essential hypertension in Xinjiang Uygur population.
21044749 Fourteen novel and six known single nucleotide polymorphisms (SNPs) including 2 nonsynonymous SNPs in the STEAP4 gene were identified. SNPs rs8122 and rs1981529 were significantly associated with the metabolic syndrome phenotype in females.
21044749 Observational study of gene-disease association. (HuGE Navigator)
20885390 Observational study of gene-disease association. (HuGE Navigator)
20382686 common polymorphisms of STAMP2 are unlikely to significantly contribute to the risk of the metabolic syndrome in the general population
20382686 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20127040 Results demonstrate that STEAP4 does not influence human adipocyte differentiation, but it participates in regulating the insulin sensitivity of human adipocytes.
19787193 STEAP4 associates with focal adhesion kinase (FAK) and regulate the activity of FAK through Y397 phosphorylation.
19289123 TIARP/STAMP2 is highly upregulated in 3T3-L1 cells and hMSC-Ad by IL-1beta and might, therefore, modulate proinflammatory and insulin resistance-inducing effects of IL-1beta.
18430367 Down-regulation of STEAP4 is associated with obesity in humans.
18381574 Human WAT STAMP2 associates with obesity and insulin resistance independently of adiponectin.

AA Sequence

MEKTCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEA      1 - 70
AKKSGIIIIAIHREHYDFLTELTEVLNGKILVDISNNLKINQYPESNAEYLAHLVPGAHVVKAFNTISAW     71 - 140
ALQSGALDASRQVFVCGNDSKAKQRVMDIVRNLGLTPMDQGSLMAAKEIEKYPLQLFPMWRFPFYLSAVL    141 - 210
CVFLFFYCVIRDVIYPYVYEKKDNTFRMAISIPNRIFPITALTLLALVYLPGVIAAILQLYRGTKYRRFP    211 - 280
DWLDHWMLCRKQLGLVALGFAFLHVLYTLVIPIRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSDSYVA    281 - 350
LGILGFFLFVLLGITSLPSVSNAVNWREFRFVQSKLGYLTLILCTAHTLVYGGKRFLSPSNLRWYLPAAY    351 - 420
VLGLIIPCTVLVIKFVLIMPCVDNTLTRIRQGWERNSKH                                   421 - 459
//

Text Mined References (35)

PMID Year Title
26510124 2015 Genetic Variants in Six-Transmembrane Epithelial Antigen of Prostate 4 Increase Risk of Developing Metabolic Syndrome in a Han Chinese Population.
25680860 2015 STAMP2 increases oxidative stress and is critical for prostate cancer.
24643198 2014 STAMPing into Mitochondria.
23953178 Association of the six transmembrane protein of prostate 2 gene polymorphisms with metabolic syndrome in Han Chinese population.
23553608 2013 Induction of STEAP4 correlates with 1,25-dihydroxyvitamin D3 stimulation of adipogenesis in mesenchymal progenitor cells derived from human adipose tissue.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23179203 2013 Six-transmembrane epithelial antigen of prostate 4 and neutrophil gelatinase-associated lipocalin expression in visceral adipose tissue is related to iron status and inflammation in human obesity.
23134829 2012 Genetic polymorphism of six transmembrane protein of prostate 2 associated with diabetes mellitus in Xinjiang Uygur population.
23095254 2012 Hepatic STAMP2 decreases hepatitis B virus X protein-associated metabolic deregulation.
22244520 Six-transmembrane epithelial antigen of prostate 4 (STEAP4) is expressed on monocytes/neutrophils, and is regulated by TNF antagonist in patients with rheumatoid arthritis.
21933608 2011 A common variation within the STEAP4 gene exons is associated with obesity in Uygur general population.
21849520 2011 Decreased STAMP2 expression in association with visceral adipose tissue dysfunction.
21718614 2011 [Association of STEAP4 genetic polymorphisms with insulin resistance in Uygur Chinese general population].
21633911 2012 Six-transmembrane epithelial antigen of prostate4 (STEAP4) is a tumor necrosis factor alpha-induced protein that regulates IL-6, IL-8, and cell proliferation in synovium from patients with rheumatoid arthritis.
21468601 Knockdown of STEAP4 inhibits insulin-stimulated glucose transport and GLUT4 translocation via attenuated phosphorylation of Akt, independent of the effects of EEA1.
21287516 2011 [Genetic variation and association of STEAP4 gene with metabolic syndrome in Chinese Uygur patients].
21287513 2011 [Negative association of STAMP2 gene polymorphisms with essential hypertension in Xinjiang Uygur population].
21044749 2010 Variations of six transmembrane epithelial antigen of prostate 4 (STEAP4) gene are associated with metabolic syndrome in a female Uygur general population.
20885390 2011 A common haplotype in NAPEPLD is associated with severe obesity in a Norwegian population-based cohort (the HUNT study).
20382686 2010 Genetic variability at the six transmembrane protein of prostate 2 locus and the metabolic syndrome: the data from an epidemiological study on the Insulin Resistance Syndrome (DESIR) study.
20127040 2010 STEAP4, a gene associated with insulin sensitivity, is regulated by several adipokines in human adipocytes.
19787193 2009 STEAP4 regulates focal adhesion kinase activation and CpG motifs within STEAP4 promoter region are frequently methylated in DU145, human androgen-independent prostate cancer cells.
19660107 2009 Tumor necrosis factor alpha-induced adipose-related protein expression in experimental arthritis and in rheumatoid arthritis.
19289123 2009 Interleukin-1beta is a positive regulator of TIARP/STAMP2 gene and protein expression in adipocytes in vitro.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18430367 2008 Downregulation of STEAP4, a highly-expressed TNF-alpha-inducible gene in adipose tissue, is associated with obesity in humans.
18381574 2008 Expression of six transmembrane protein of prostate 2 in human adipose tissue associates with adiposity and insulin resistance.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16227996 2005 Identification of a ferrireductase required for efficient transferrin-dependent iron uptake in erythroid cells.
15897894 2005 Molecular cloning and characterization of STAMP2, an androgen-regulated six transmembrane protein that is overexpressed in prostate cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11443137 2001 Tumor necrosis factor-alpha-induced adipose-related protein (TIARP), a cell-surface protein that is highly induced by tumor necrosis factor-alpha and adipose conversion.