Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.72
PubTator Score 4.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -2.300 1.1e-04
astrocytic glioma -2.300 4.2e-03
Astrocytoma, Pilocytic -3.000 1.5e-09
atypical teratoid / rhabdoid tumor -3.400 6.3e-11
cystic fibrosis -1.981 5.5e-06
ependymoma -2.200 3.2e-03
glioblastoma -2.400 1.4e-08
group 4 medulloblastoma -1.300 7.5e-03
medulloblastoma, large-cell -2.100 1.7e-04
oligodendroglioma -1.300 3.2e-02
osteosarcoma -2.345 1.3e-03
primary pancreatic ductal adenocarcinoma -1.055 3.9e-03
primitive neuroectodermal tumor -2.400 1.1e-03
subependymal giant cell astrocytoma -2.815 1.6e-02
tuberculosis and treatment for 3 months 1.200 4.8e-06

 GO Function (1)

Gene RIF (4)

AA Sequence

MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLSPPLTAPPTMKSSEFFEMLEKMQGIK      1 - 70
LEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQVILPQFGGYWIEDPENVGTPTSLGSSICEEEEEDNLS     71 - 140
PNTFGYKLECKGEARAYRRHFLGKDHLNFYCTGSSLGNLILSVKCEEAEGIEYLRVILRSKLKTVHERIP    141 - 210
LAGLSKLPSVPQIAKAFCDDAVGLRFNPVLYPKASQMIVSYDEHEVNNTFKFGVIYQKARQTLEEELFGN    211 - 280
NEESPAFKEFLDLLGDTITLQDFKGFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKLPFTDGDAQQLQ    281 - 350
RKRHIGNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQVETPGTETPSYKVSVTAREDVPTFGPPLPSPP    351 - 420
VFQKGPEFREFLLTKLTNAENACCKSDKFAKLEDRTRAALLDNLHDELHAHTQAMLGLGPEEDKFENGGH    421 - 490
GGFLESFKRAIRVRSHSMETMVGGQKKSHSGGIPGSLSGGISHNSMEVTKTTFSPPVVAATVKNQSRSPI    491 - 560
KRRSGLFPRLHTGSEGQGDSRARCDSTSSTPKTPDGGHSSQEIKSETSSNPSSPEICPNKEKPFMKLKEN    561 - 630
GRAISRSSSSTSSVSSTAGEGEAMEEGDSGGSQPSTTSPFKQEVFVYSPSPSSESPSLGAAATPIIMSRS    631 - 700
PTDAKSRNSPRSNLKFRFDKLSHASSGAGH                                            701 - 730
//

Text Mined References (21)

PMID Year Title