Property Summary

NCBI Gene PubMed Count 13
PubMed Score 3.72
PubTator Score 4.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Asthma 349
Disease Target Count P-value
oligodendroglioma 2849 1.81487653953006E-15
posterior fossa group A ependymoma 1511 4.73423330091241E-14
atypical teratoid / rhabdoid tumor 4369 6.29139505445451E-11
pilocytic astrocytoma 3086 1.33442730681879E-9
pediatric high grade glioma 2712 2.57636486141407E-9
glioblastoma 5572 6.17835474229638E-9
cystic fibrosis 1670 5.54479238797856E-6
medulloblastoma, large-cell 6234 1.69656132681224E-4
tuberculosis and treatment for 6 months 686 2.34317361088063E-4
medulloblastoma 1524 4.07618449579979E-4
primitive neuroectodermal tumor 3031 0.00106704070132615
osteosarcoma 7933 0.00130870542591264
primary pancreatic ductal adenocarcinoma 1271 0.00391406088456031
astrocytic glioma 2241 0.00418548429867719
subependymal giant cell astrocytoma 2287 0.0161280580100521
Disease Target Count Z-score Confidence
Heart disease 279 0.0 1.0

Expression

Synonym

Accession Q684P5 B2RTY5 Q684P4 Q6AI00 Q6ZVF0 Q9UPW2 Rap1GAP2
Symbols GARNL4
RAP1GA3

Gene

PANTHER Protein Class (2)

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid

 GO Function (1)

Gene RIF (4)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19528539 Slp1 inhibits dense granule secretion in platelets and that Rap1GAP2 modulates secretion by binding to Slp1.
18039662 Platelet activation by ADP and thrombin enhances serine 9 phosphorylation and increases 14-3-3 binding to endogenous Rap1GAP2.
15632203 Rap1GAP2 is the first GTPase-activating protein of Rap1 found in platelets and is likely to have an important regulatory role in platelet aggregation

AA Sequence

MFGRKRSVSFGGFGWIDKTMLASLKVKKQELANSSDATLPDRPLSPPLTAPPTMKSSEFFEMLEKMQGIK      1 - 70
LEEQKPGPQKNKDDYIPYPSIDEVVEKGGPYPQVILPQFGGYWIEDPENVGTPTSLGSSICEEEEEDNLS     71 - 140
PNTFGYKLECKGEARAYRRHFLGKDHLNFYCTGSSLGNLILSVKCEEAEGIEYLRVILRSKLKTVHERIP    141 - 210
LAGLSKLPSVPQIAKAFCDDAVGLRFNPVLYPKASQMIVSYDEHEVNNTFKFGVIYQKARQTLEEELFGN    211 - 280
NEESPAFKEFLDLLGDTITLQDFKGFRGGLDVTHGQTGVESVYTTFRDREIMFHVSTKLPFTDGDAQQLQ    281 - 350
RKRHIGNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQVETPGTETPSYKVSVTAREDVPTFGPPLPSPP    351 - 420
VFQKGPEFREFLLTKLTNAENACCKSDKFAKLEDRTRAALLDNLHDELHAHTQAMLGLGPEEDKFENGGH    421 - 490
GGFLESFKRAIRVRSHSMETMVGGQKKSHSGGIPGSLSGGISHNSMEVTKTTFSPPVVAATVKNQSRSPI    491 - 560
KRRSGLFPRLHTGSEGQGDSRARCDSTSSTPKTPDGGHSSQEIKSETSSNPSSPEICPNKEKPFMKLKEN    561 - 630
GRAISRSSSSTSSVSSTAGEGEAMEEGDSGGSQPSTTSPFKQEVFVYSPSPSSESPSLGAAATPIIMSRS    631 - 700
PTDAKSRNSPRSNLKFRFDKLSHASSGAGH                                            701 - 730
//

Text Mined References (21)

PMID Year Title
24824216 2014 Genome-wide interaction studies reveal sex-specific asthma risk alleles.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24284068 2014 Slp2-a controls renal epithelial cell size through regulation of Rap-ezrin signaling independently of Rab27.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19528539 2009 Synaptotagmin-like protein 1 interacts with the GTPase-activating protein Rap1GAP2 and regulates dense granule secretion in platelets.
More...