Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.40
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 9.45361409834359E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 1.90306932631892E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 9.63465209545928E-4
gastric carcinoma 832 0.02734759662822

Expression

  Differential Expression (4)

Synonym

Accession Q67FW5 Q6GV30 Q8WUT3 BGnT-like protein 1
Symbols B3GNT8
BGnT-8
beta-1
3-Gn-T8
beta3Gn-T8
beta3GnTL1

Gene

PANTHER Protein Class (2)

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
C. elegans OMA EggNOG

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
15560372 beta3-GnTL1 is similar to beta1, 3-N-acetylglucosaminyltransferase

AA Sequence

MSGAGVGGASEESQAMQAHVSIILPVHNAEPWLDECLRSVLQQDFEGTMELSVFNDASKDKSGAIIEKWR      1 - 70
VKLEDSGVHVIIGGHDSPSPRGVGYAKNQAVAQSSGSYLCFLDSDDVMMPQRVRLQHEAAVQHPSSIIGC     71 - 140
RVRRDPPNSTERYTRWINQLTPEQLLTQVFTSNGPTVIMPTWFCSRAWFSHVGPFNEGGQGVPEDLLFFY    141 - 210
EHLRKGGGVIRVDQSLLLYRHHPQAATHCVLETTIWTHRVRFLEEQALPRWAAFTIWNAGKQGRRLYRSL    211 - 280
TAGSQRKVVAFCDVDENKIRKGFYCHEDSQERPKPRIPILHFRAARPPFVICVKLDLTGGAFEDNLRSLH    281 - 350
LQEGQDFLHFS                                                               351 - 361
//

Text Mined References (6)

PMID Year Title
15560372 2004 Characterization of a cDNA encoding a protein with limited similarity to beta1, 3-N-acetylglucosaminyltransferase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.