Property Summary

NCBI Gene PubMed Count 138
Grant Count 80
R01 Count 46
Funding $9,687,998.28
PubMed Score 165.79
PubTator Score 159.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.398 0.000
tuberculosis and treatment for 6 months 1.300 0.000
Pick disease 1.100 0.000

Synonym

Accession Q676U5 A3EXK9 A3EXL0 B6ZDH0 Q6IPN1 Q6UXW4 Q6ZVZ5 Q8NCY2 Q96JV5 Q9H619
Symbols IBD10
WDR30
APG16L
ATG16A
ATG16L

Gene

PDB

4GDK   4GDL   4NAW   4TQ0   5D7G  

Gene RIF (146)

PMID Text
26837467 Knockdown of Atg16L1, a crucial autophagy gene, leads to developmental retention of early-stage cells in various tissues where the differentiation of stem cells is retarded.
26226011 Subjects homozygous for the autophagy-related 16-like protein (ATG16L1) CD-associated gene variant (rs2241880), had low SHIP mRNA expression and activity.
26165754 The signaling axis of HIF-1a, miR-20a-5p, and ATG16L1 in autophagic process might be a critical adapting mechanism for ischemic kidney injury.
26095365 Antibacterial autophagy is impaired in CLEC12A-deficient cells, and this effect is exacerbated in the presence of the ATG16L1( *)300A risk allele.
26083323 ATG16L1 as a bona fide physiological CSNK2 and PPP1 substrate, which reveals a novel molecular link from CSNK2 to activation of the autophagy-specific ATG12-ATG5-ATG16L1 complex and autophagy induction
25886994 decreased expression in colon biopsies of Crohn's disease patients; conversely, increased expression in ulcerative colitis patients
25883416 CNTNAP3 could upregulate the expression of ATG16L1 and increase autophagy vacuoles
25767270 ATG16L1 expression could influence vascular endothelial function during atherogenesis.
25738374 ATG16L1 variant rs2241880 was associated with 38% increase in the risk for Crohn's disease for higher mutational load, whereas IL23R variant rs11209026 decreased the risk by 54% for higher mutational load.
25712183 genotyped 31 Crohn's disease (CD)-associated genes in 102 Slovenian patients. The strongest association for treatment response defined as decrease in CRP levels was found for ATG16L1 SNP rs10210302.
More...

AA Sequence

MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEIS      1 - 70
PGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISD     71 - 140
LETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENE    141 - 210
KDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSIT    211 - 280
NIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWE    281 - 350
VFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDN    351 - 420
ARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGK    421 - 490
ITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYI    491 - 560
WSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY                           561 - 607
//

Text Mined References (145)

PMID Year Title
26837467 2016 Autophagy regulates Notch degradation and modulates stem cell development and neurogenesis.
26347139 2015 TRIM-mediated precision autophagy targets cytoplasmic regulators of innate immunity.
26226011 2015 The Crohn's disease-associated polymorphism in ATG16L1 (rs2241880) reduces SHIP gene expression and activity in human subjects.
26165754 2015 MiR-20a-5p mediates hypoxia-induced autophagy by targeting ATG16L1 in ischemic kidney injury.
26095365 2015 Integrated Genomics of Crohn's Disease Risk Variant Identifies a Role for CLEC12A in Antibacterial Autophagy.
26083323 2015 ATG16L1 phosphorylation is oppositely regulated by CSNK2/casein kinase 2 and PPP1/protein phosphatase 1 which determines the fate of cardiomyocytes during hypoxia/reoxygenation.
25886994 2015 MicroRNA signatures differentiate Crohn's disease from ulcerative colitis.
25883416 2015 CNTNAP3 associated ATG16L1 expression and Crohn's disease.
25767270 2015 ATG16L1 Expression in Carotid Atherosclerotic Plaques Is Associated With Plaque Vulnerability.
25738374 2015 ATG16L1 and IL23R variants and genetic susceptibility to crohn's disease: mode of inheritance based on meta-analysis of genetic association studies.
More...