Property Summary

NCBI Gene PubMed Count 19
PubMed Score 18.90
PubTator Score 5.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 5.200 0.000
esophageal adenocarcinoma -1.300 0.043
psoriasis -1.300 0.004
osteosarcoma 2.532 0.000
glioblastoma -1.600 0.000
group 4 medulloblastoma -4.000 0.000
cystic fibrosis -1.489 0.000
astrocytoma 1.100 0.004
atypical teratoid / rhabdoid tumor -1.500 0.000
medulloblastoma, large-cell -2.700 0.001
lung cancer -1.700 0.004
active ulcerative colitis 1.138 0.017
adult high grade glioma -1.500 0.000
posterior fossa group B ependymoma -1.200 0.000
subependymal giant cell astrocytoma -1.982 0.004
invasive ductal carcinoma -1.195 0.001
spina bifida -2.246 0.030
Pick disease -1.100 0.001
ovarian cancer 1.700 0.001
pituitary cancer -2.000 0.000
sarcoidosis -1.300 0.030

Gene RIF (7)

PMID Text
22513779 exons 5-15 of kazrin, encoding the nuclear localization signal and C-terminal domain, are not required for epidermal development and function
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19843585 kazrinE is a kazrin isoform with a liprin-homology domain(LHD), and associates with stabilised microtubules via its LHD. Overexpressed kazrinE in epidermal keratinocytes induces changes in cell shape and stimulates terminal differentiation.
19727525 These results suggested that Kazrin F might play an important role in regulating cellular apoptosis by interacting with ARC and Bax.
18840647 kazrin is a dual regulator of intercellular adhesion and differentiation in keratinocytes and regulates these processes by Rho-dependent and -independent mechanisms
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15337775 Kazrin colocalizes with periplakin and desmoplakin at desmosomes and with periplakin at the interdesmosomal plasma membrane, but its subcellular distribution is independent of periplakin [kazrin]

AA Sequence

MMEDNKQLALRIDGAVQSASQEVTNLRAELTATNRRLAELSGGGGPGPGPGAAASASAAGDSAATNMENP      1 - 70
QLGAQVLLREEVSRLQEEVHLLRQMKEMLAKDLEESQGGKSSEVLSATELRVQLAQKEQELARAKEALQA     71 - 140
MKADRKRLKGEKTDLVSQMQQLYATLESREEQLRDFIRNYEQHRKESEDAVKALAKEKDLLEREKWELRR    141 - 210
QAKEATDHATALRSQLDLKDNRMKELEAELAMAKQSLATLTKDVPKRHSLAMPGETVLNGNQEWVVQADL    211 - 280
PLTAAIRQSQQTLYHSHPPHPADRQAVRVSPCHSRQPSVISDASAAEGDRSSTPSDINSPRHRTHSLCNG    281 - 350
DSPGPVQKNLHNPIVQSLEDLEDQKRKKKKEKMGFGSISRVFARGKQRKSLDPGLFDDSDSQCSPTRQSL    351 - 420
SLSEGEEQMDRLQQVELVRTTPMSHWKAGTVQAWLEVVMAMPMYVKACTENVKSGKVLLSLSDEDLQLGL    421 - 490
GVCSSLHRRKLRLAIEDYRDAEAGRSLSKAAELDHHWVAKAWLNDIGLSQYSQAFQNHLVDGRMLNSLMK    491 - 560
RDLEKHLNVSKKFHQVSILLGIELLYQVNFSREALQERRARCETQNIDPVVWTNQRVLKWVRDIDLKEYA    561 - 630
DNLTNSGVHGAVLVLEPTFNAEAMATALGIPSGKHILRRHLAEEMSAVFHPANSTGIREAERFGTPPGRA    631 - 700
SSVTRAGKEENSSGLKYKAGRLPLGKIGRGFSSKDPDFHDDYGSLQNEDCGDDDPQSRLEQCRLEGYNSL    701 - 770
EVTNV                                                                     771 - 775
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23144326 2012 Genome-wide association analysis of blood biomarkers in chronic obstructive pulmonary disease.
22513779 2012 Exons 5-15 of kazrin are dispensable for murine epidermal morphogenesis and homeostasis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19843585 2009 KazrinE is a desmosome-associated liprin that colocalises with acetylated microtubules.
19727525 2009 Kazrin F is involved in apoptosis and interacts with BAX and ARC.
18840647 2008 Kazrin regulates keratinocyte cytoskeletal networks, intercellular junctions and differentiation.
More...