Property Summary

NCBI Gene PubMed Count 19
PubMed Score 18.59
PubTator Score 5.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
active ulcerative colitis 1.138 1.7e-02
adult high grade glioma -1.500 1.8e-04
astrocytoma 1.100 3.8e-03
atypical teratoid / rhabdoid tumor -1.500 5.0e-04
cystic fibrosis -1.453 6.4e-06
esophageal adenocarcinoma -1.300 4.3e-02
glioblastoma -1.200 8.3e-06
group 3 medulloblastoma -3.400 2.6e-06
invasive ductal carcinoma -1.195 5.7e-04
lung cancer -1.100 9.1e-03
malignant mesothelioma 5.200 8.8e-09
medulloblastoma, large-cell -1.500 2.6e-02
osteosarcoma 2.532 1.9e-04
ovarian cancer 1.700 1.1e-03
Pick disease -1.100 1.2e-03
pituitary cancer -2.000 4.1e-05
posterior fossa group B ependymoma -1.200 1.1e-06
psoriasis -1.300 3.9e-03
sarcoidosis -1.300 3.0e-02
spina bifida -2.246 3.0e-02
subependymal giant cell astrocytoma -1.982 3.7e-03

Protein-protein Interaction (1)

Gene RIF (7)

AA Sequence

MMEDNKQLALRIDGAVQSASQEVTNLRAELTATNRRLAELSGGGGPGPGPGAAASASAAGDSAATNMENP      1 - 70
QLGAQVLLREEVSRLQEEVHLLRQMKEMLAKDLEESQGGKSSEVLSATELRVQLAQKEQELARAKEALQA     71 - 140
MKADRKRLKGEKTDLVSQMQQLYATLESREEQLRDFIRNYEQHRKESEDAVKALAKEKDLLEREKWELRR    141 - 210
QAKEATDHATALRSQLDLKDNRMKELEAELAMAKQSLATLTKDVPKRHSLAMPGETVLNGNQEWVVQADL    211 - 280
PLTAAIRQSQQTLYHSHPPHPADRQAVRVSPCHSRQPSVISDASAAEGDRSSTPSDINSPRHRTHSLCNG    281 - 350
DSPGPVQKNLHNPIVQSLEDLEDQKRKKKKEKMGFGSISRVFARGKQRKSLDPGLFDDSDSQCSPTRQSL    351 - 420
SLSEGEEQMDRLQQVELVRTTPMSHWKAGTVQAWLEVVMAMPMYVKACTENVKSGKVLLSLSDEDLQLGL    421 - 490
GVCSSLHRRKLRLAIEDYRDAEAGRSLSKAAELDHHWVAKAWLNDIGLSQYSQAFQNHLVDGRMLNSLMK    491 - 560
RDLEKHLNVSKKFHQVSILLGIELLYQVNFSREALQERRARCETQNIDPVVWTNQRVLKWVRDIDLKEYA    561 - 630
DNLTNSGVHGAVLVLEPTFNAEAMATALGIPSGKHILRRHLAEEMSAVFHPANSTGIREAERFGTPPGRA    631 - 700
SSVTRAGKEENSSGLKYKAGRLPLGKIGRGFSSKDPDFHDDYGSLQNEDCGDDDPQSRLEQCRLEGYNSL    701 - 770
EVTNV                                                                     771 - 775
//

Text Mined References (23)

PMID Year Title