Property Summary

NCBI Gene PubMed Count 12
PubMed Score 29.41
PubTator Score 7.42

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MPRCTYQLEQNPGFLPDGPGVHARAHCQDLSGPYGHEFATSESLGGRVGKTRAPQSGARSRMERAGPAGE      1 - 70
EGGAREGRLLPRAPGAWVLRACAERAALEVGAASADTGVRGCGARGPAPLLASAGGGRARDGTWGVRTKG     71 - 140
SGAALPSRPASRAAPRPEASSPPLPLEKARGGLSGPQGGRARGAMAHVGSRKRSRSRSRSRGRGSEKRKK    141 - 210
KSRKDTSRNCSASTSQGRKASTAPGAEASPSPCITERSKQKARRRTRSSSSSSSSSSSSSSSSSSSSSSS    211 - 280
SSDGRKKRGKYKDKRRKKKKKRKKLKKKGKEKAEAQQVEALPGPSLDQWHRSAGEEEDGPVLTDEQKSRI    281 - 350
QAMKPMTKEEWDARQSIIRKVVDPETGRTRLIKGDGEVLEEIVTKERHREINKQATRGDCLAFQMRAGLL    351 - 420
P//

Text Mined References (27)

PMID Year Title