Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.12
PubTator Score 5.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (4)

AA Sequence

MAGAGGGGCPAGGNDFQWCFSQVKGAIDEDVAEADIISTVEFNYSGDLLATGDKGGRVVIFQREQENKSR      1 - 70
PHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLSTNDKTIKLWKISERDKRAEGY     71 - 140
NLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFANAHTYHINSISVNSDHETYLSADDLRINLWH    141 - 210
LEITDRSFNIVDIKPANMEELTEVITAAEFHPHQCNVFVYSSSKGTIRLCDMRSSALCDRHSKFFEEPED    211 - 280
PSSRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKVWDLNMESRPVETHQVHEYLRSKLCSLYENDCIFD    281 - 350
KFECCWNGSDSAIMTGSYNNFFRMFDRDTRRDVTLEASRESSKPRASLKPRKVCTGGKRRKDEISVDSLD    351 - 420
FNKKILHTAWHPVDNVIAVAATNNLYIFQDKIN                                         421 - 453
//

Text Mined References (16)

PMID Year Title