Property Summary

NCBI Gene PubMed Count 22
PubMed Score 33.65
PubTator Score 28.96

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
26968897 Whole exome sequencing has unraveled the presence of pathogenic mutations in genes encoding non-mitochondrial proteins, such as in the transcription factor E4F1.
24163401 results suggest that E4F1 may neutralize the capacity of HBx to activate a p53-dependent, metabolic and growth arrest phenotype in liver cells, thus possibly contributing to the viability and proliferation of HBV-infected cells
21708927 Short hairpin RNA-mediated depletion of E4F1 induced mitochondrial defects and ROS-mediated death in several myeloid leukemia cell lines.
17557114 LANP and ATAXN1 interact in E4F-mediated transcriptional repression.
17110336 E4F1 is a key posttranslational regulator of p53, which modulates its effector functions involved in alternative cell fates: growth arrest or apoptosis.
16652157 findings show that full-length E4F1 protein but not its E1A-activated & truncated form interacts in vitro & in vivo with FHL2; this E4F1-FHL2 association occurs in the nuclear compartment & inhibits the capacity of E4F1 to block cell proliferation
15579445 E4F1 function involves ER alpha-mediated inhibition of VSMC proliferation and estrogen-related atheroprotection of human
14729613 Specific inactivation of RASSF1A by short interfering RNA disrupts binding of RASSF1A to p120(E4F) in tumor cells.
12446718 association of p120E4F with p14ARF enhances cell cycle inhibition

AA Sequence

MEGAMAVRVTAAHTAEAQAEAGREAGEGAVAAVAAALAPSGFLGLPAPFSEEDEDDVHRCGRCQAEFTAL      1 - 70
EDFVQHKIQKACQRAPPEALPATPATTALLGQEVVPAAPGPEEPITVAHIVVEAASLAADISHASDLVGG     71 - 140
GHIKEVIVAAEAELGDGEMAEAPGSPRQQGLGLAGEGEQAQVKLLVNKDGRYVCALCHKTFKTGSILKAH    141 - 210
MVTHSSRKDHECKLCGASFRTKGSLIRHHRRHTDERPYKCSKCGKSFRESGALTRHLKSLTPCTEKIRFS    211 - 280
VSKDVVVSKEDARAGSGAGAAGLGTATSSVTGEPIETSPVIHLVTDAKGTVIHEVHVQMQELSLGMKALA    281 - 350
PEPPVSQELPCSSEGSRENLLHQAMQNSGIVLERAAGEEGALEPAPAAGSSPQPLAVAAPQLPVLEVQPL    351 - 420
ETQVASEASAVPRTHPCPQCSETFPTAATLEAHKRGHTGPRPFACAQCGKAFPKAYLLKKHQEVHVRERR    421 - 490
FRCGDCGKLYKTIAHVRGHRRVHSDERPYPCPKCGKRYKTKNAQQVHFRTHLEEKPHVCQFCSRGFREKG    491 - 560
SLVRHVRHHTGEKPFKCYKCGRGFAEHGTLNRHLRTKGGCLLEVEELLVSEDSPAAATTVLTEDPHTVLV    561 - 630
EFSSVVADTQEYIIEATADDAETSEATEIIEGTQTEVDSHIMKVVQQIVHQASAGHQIIVQNVTMDEETA    631 - 700
LGPEAAAADTITIATPESLTEQVAMTLASAISEGTVLAARAGTSGTEQATVTMVSSEDIEILEHAGELVI    701 - 770
ASPEGQLEVQTVIV                                                            771 - 784
//

Text Mined References (35)

PMID Year Title
26968897 2016 New genes and pathomechanisms in mitochondrial disorders unraveled by NGS technologies.
24163401 2014 Downregulation of transcription factor E4F1 in hepatocarcinoma cells: HBV-dependent effects on autophagy, proliferation and metabolism.
21708927 2011 E4F1 deficiency results in oxidative stress-mediated cell death of leukemic cells.
21666599 2011 Modulation of Tcf3 repressor complex composition regulates cdx4 expression in zebrafish.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17557114 2007 The role of LANP and ataxin 1 in E4F-mediated transcriptional repression.
17110336 2006 E4F1 is an atypical ubiquitin ligase that modulates p53 effector functions independently of degradation.
16882984 2006 E4F1: a novel candidate factor for mediating BMI1 function in primitive hematopoietic cells.
More...