Property Summary

NCBI Gene PubMed Count 19
Grant Count 7
R01 Count 5
Funding $459,732.83
PubMed Score 34.58
PubTator Score 22.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.098 0.001
spina bifida 1.185 0.035
ovarian cancer 1.200 0.000
Gaucher disease type 1 1.100 0.027

Gene RIF (14)

PMID Text
26540094 HDAC4 destabilizes MAP1S, suppresses autophagy flux and promotes the accumulation of mHTT aggregates.
25505242 results support a role for MAP1 proteins in promoting efficient retrograde trafficking of HIV-1 by stimulating the formation of stable microtubules and mediating the association of HIV-1 cores with microtubules.
25505242 MAP1A and MAP1S proteins activate HIV-1 retrograde trafficking by tethering capsids to microtubules in primary human macrophages
25505242 MAP1A and MAP1S proteins activate HIV-1 retrograde trafficking by tethering capsids to microtubules in primary human macrophages
25505242 MAP1A and MAP1S proteins activate HIV-1 retrograde trafficking by tethering capsids to microtubules in primary human macrophages
25505242 Knockdown of MAP1S by shRNA inhibits HIV-1 infectivity in human PBMCs
25300793 Ddata underline the key role of MAP1S as a global regulator of microbutule stability and demonstrate a new primary function of MAP1S to regulate MT dynamics at the onset of cytokinesis.
25043887 The PU.1-regulated MAP1S gene is implicated in neutrophil differentiation and autophagy control.
21262964 clarify roles of MAP1S in bridging microtubules and mitochondria with autophagic and mitophagic initiation, maturation, trafficking, and lysosomal clearance.
19759419 C19ORF5 distributed broadly across the mitotic spindle and reversibly accumulated during reversible mitotic arrest.
More...

AA Sequence

MAAVAGSGAAAAPSSLLLVVGSEFGSPGLLTYVLEELERGIRSWDVDPGVCNLDEQLKVFVSRHSATFSS      1 - 70
IVKGQRSLHHRGDNLETLVLLNPSDKSLYDELRNLLLDPASHKLLVLAGPCLEETGELLLQTGGFSPHHF     71 - 140
LQVLKDREIRDILATTPPPVQPPILTITCPTFGDWAQLAPAVPGLQGALRLQLRLNPPAQLPNSEGLCEF    141 - 210
LEYVAESLEPPSPFELLEPPTSGGFLRLGRPCCYIFPGGLGDAAFFAVNGFTVLVNGGSNPKSSFWKLVR    211 - 280
HLDRVDAVLVTHPGADSLPGLNSLLRRKLAERSEVAAGGGSWDDRLRRLISPNLGVVFFNACEAASRLAR    281 - 350
GEDEAELALSLLAQLGITPLPLSRGPVPAKPTVLFEKMGVGRLDMYVLHPPSAGAERTLASVCALLVWHP    351 - 420
AGPGEKVVRVLFPGCTPPACLLDGLVRLQHLRFLREPVVTPQDLEGPGRAESKESVGSRDSSKREGLLAT    421 - 490
HPRPGQERPGVARKEPARAEAPRKTEKEAKTPRELKKDPKPSVSRTQPREVRRAASSVPNLKKTNAQAAP    491 - 560
KPRKAPSTSHSGFPPVANGPRSPPSLRCGEASPPSAACGSPASQLVATPSLELGPIPAGEEKALELPLAA    561 - 630
SSIPRPRTPSPESHRSPAEGSERLSLSPLRGGEAGPDASPTVTTPTVTTPSLPAEVGSPHSTEVDESLSV    631 - 700
SFEQVLPPSAPTSEAGLSLPLRGPRARRSASPHDVDLCLVSPCEFEHRKAVPMAPAPASPGSSNDSSARS    701 - 770
QERAGGLGAEETPPTSVSESLPTLSDSDPVPLAPGAADSDEDTEGFGVPRHDPLPDPLKVPPPLPDPSSI    771 - 840
CMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSARSEPSEKGG    841 - 910
RAPLSRKSSTPKTATRGPSGSASSRPGVSATPPKSPVYLDLAYLPSGSSAHLVDEEFFQRVRALCYVISG    911 - 980
QDQRKEEGMRAVLDALLASKQHWDRDLQVTLIPTFDSVAMHTWYAETHARHQALGITVLGSNSMVSMQDD    981 - 1050
AFPACKVEF                                                                1051 - 1059
//

Text Mined References (40)

PMID Year Title
26540094 2015 Blocking the association of HDAC4 with MAP1S accelerates autophagy clearance of mutant Huntingtin.
25505242 2015 Microtubule-associated proteins 1 (MAP1) promote human immunodeficiency virus type I (HIV-1) intracytoplasmic routing to the nucleus.
25300793 2014 MAP1S controls microtubule stability throughout the cell cycle in human cells.
25043887 2014 Induction of the autophagy-associated gene MAP1S via PU.1 supports APL differentiation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22523538 2012 Nemitin, a novel Map8/Map1s interacting protein with Wd40 repeats.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21262964 2011 Microtubule-associated protein 1S (MAP1S) bridges autophagic components with microtubules and mitochondria to affect autophagosomal biogenesis and degradation.
More...