Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.40
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 1.2e-06
atypical teratoid / rhabdoid tumor 5112 1.1e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 1.1e-05
osteosarcoma 1.138 1.2e-06

Gene RIF (1)

AA Sequence

MPGTVATLRFQLLPPEPDDAFWGAPCEQPLERRYQALPALVCIMCCLFGVVYCFFGYRCFKAVLFLTGLL      1 - 70
FGSVVIFLLCYRERVLETQLSAGASAGIALGIGLLCGLVAMLVRSVGLFLVGLLLGLLLAAAALLGSAPY     71 - 140
YQPGSVWGPLGLLLGGGLLCALLTLRWPRPLTTLATAVTGAALIATAADYFAELLLLGRYVVERLRAAPV    141 - 210
PPLCWRSWALLALWPLLSLMGVLVQWRVTAEGDSHTEVVISRQRRRVQLMRIRQQEDRKEKRRKKRPPRA    211 - 280
PLRGPRAPPRPGPPDPAYRRRPVPIKRFNGDVLSPSYIQSFRDRQTGSSLSSFMASPTDADYEYGSRGPL    281 - 350
TACSGPPVRV                                                                351 - 360
//

Text Mined References (4)

PMID Year Title