Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.44

Knowledge Summary


No data available


  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 5.5e-07
glioblastoma 1.400 3.4e-05
group 4 medulloblastoma 1.400 2.2e-03
malignant mesothelioma 1.400 2.5e-06
medulloblastoma, large-cell 1.100 8.3e-04
pediatric high grade glioma 1.100 1.6e-03
primitive neuroectodermal tumor 1.100 5.5e-04
psoriasis -1.200 1.4e-04
Rheumatoid arthritis -1.500 1.9e-02


Accession Q66K64 B3KS86 Q96DW0 Q9BU31
Symbols C19orf72


  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

KWLVPESSGRYVNRMTNEALHKGCSLKVLADSERYTWIVL                                  561 - 600

Text Mined References (10)

PMID Year Title