Property Summary

NCBI Gene PubMed Count 26
PubMed Score 15.21
PubTator Score 14.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 9.56742794282029E-9
ulcerative colitis 2087 2.00082838878841E-8
glioblastoma 5572 2.49546058721239E-7
atypical teratoid/rhabdoid tumor 1095 3.21938724084613E-7
psoriasis 6685 1.14335535347243E-5
pilocytic astrocytoma 3086 1.7050929770277E-5
group 3 medulloblastoma 2254 2.09635984570371E-5
tuberculosis and treatment for 6 months 686 3.12831405644453E-5
pediatric high grade glioma 2712 5.79660122004126E-5
nasopharyngeal carcinoma 1056 6.09376132138251E-5
primitive neuroectodermal tumor 3031 0.00228974179132269
osteosarcoma 7933 0.0102469035503163
ovarian cancer 8492 0.0156553162196231
non primary Sjogren syndrome sicca 840 0.0198264148729855
spina bifida 1064 0.0356293316343463
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Microcephaly 149 4.317 2.2
Intellectual disability 573 0.0 4.0
Disease Target Count Z-score Confidence
Diabetic macular edema 8 3.009 1.5

Expression

  Differential Expression (15)

Synonym

Accession Q66GS9 B2RMY0 O75130 Q58F25 Q9H8H7 Cep135
Symbols CEP4
MCPH8
KIAA0635

Gene

PANTHER Protein Class (2)

PDB

5FCN  

  Ortholog (13)

Gene RIF (5)

PMID Text
26412126 Authors suggest that the decrease in CEP135(mini) from centrosomes promotes centriole assembly. The repression of centriole duplication by a splice isoform of a protein that normally promotes it serves as a novel mechanism to limit centriole duplication.
25086031 These findings support a model in which PKC-mediated phosphorylation of CEP4 at Ser(18) and Ser(80) causes its dissociation from Cdc42, thereby increasing its affinity for TEM4 and producing Rac activation, filopodium formation, and cell motility
23511974 Authors propose that CEP135 directly connects the central hub protein, hSAS-6, to the outer microtubules, and suggest that this interaction stabilizes the proper cartwheel structure for further CPAP-mediated centriole elongation.
22521416 A truncating mutation of CEP135 caused autosomal-recessive primary microcephaly in a Pakistani family.
18851962 CEP135 acts as a platform protein for C-NAP1 at the centriole.

AA Sequence

MTTAVERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRQSKLSAVKAEKESANFDFVLEP      1 - 70
YKLENARLSRENNELYLELMKLREHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNE     71 - 140
RIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPVPPSEVSSYPVPQPDDPYIADLLQVADNRIQELQ    141 - 210
QEVHQLQEKLAMMESGVRDYSKQIELREREIERLSVALDGGRSPDVLSLESRNKTNEKLIAHLNIQVDFL    211 - 280
QQANKDLEKRIRELMETKETVTSEVVNLSNKNEKLCQELTEIDQLAQQLERHKEEVLETADKELGEAKKE    281 - 350
IKRKLSEMQDLEETMAKLQLELNLCQKEKERLSDELLVKSDLETVVHQLEQEKQRLSKKVESFAVTERQL    351 - 420
TLEVERMRLEHGIKRRDRSPSRLDTFLKGIEEERDYYKKELERLQHIIQRRSCSTSYSAREKSSIFRTPE    421 - 490
KGDYNSEIHQITRERDELQRMLERFEKYMEDIQSNVKLLTAERDKLSVLYNEAQEELSALRKESTQTTAP    491 - 560
HNIVSLMEKEKELALSDLRRIMAEKEALREKLEHIEEVSLFGKSELEKTIEHLTCVNHQLESEKYELKSK    561 - 630
VLIMKETIESLENKLKVQAQKFSHVAGDSSHQKTEVNSLRIVNEQLQRSVDDYQHRLSIKRGELESAQAQ    631 - 700
IKILEEKIDELNLKMTSQDEEAHVMKKTIGVIDKEKDFLQETVDEKTEKIANLQENLANKEKAVAQMKIM    701 - 770
ISECESSVNQLKETLVNRDREINSLRRQLDAAHKELDEVGRSREIAFKENRRLQDDLATMARENQEISLE    771 - 840
LEAAVQEKEEMKSRVHKYITEVSRWESLMAAKEKENQDLLDRFQMLHNRAEDWEVKAHQAEGESSSVRLE    841 - 910
LLSIDTERRHLRERVELLEKEIQEHINAHHAYESQISSMAKAMSRLEEELRHQEDEKATVLNDLSSLREL    911 - 980
CIKLDSGKDIMTQQLNSKNLEFERVVVELENVKSESDLLKKQLSNERHTVKNLESLLATNRDKEFHSHLT    981 - 1050
SHEKDTEIQLLKEKLTLSESKLTSQSRENTMLRAKVAQLQTDYDALKRQISTERYERERAIQEMRRHGLA   1051 - 1120
TPPLSSTLRSPSHSPEHRNV                                                     1121 - 1140
//

Text Mined References (29)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26675238 2016 WDR8 is a centriolar satellite and centriole-associated protein that promotes ciliary vesicle docking during ciliogenesis.
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26545777 2015 The conserved Wdr8-hMsd1/SSX2IP complex localises to the centrosome and ensures proper spindle length and orientation.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26412126 2015 A Short CEP135 Splice Isoform Controls Centriole Duplication.
25086031 2014 Phosphorylation of Cdc42 effector protein-4 (CEP4) by protein kinase C promotes motility of human breast cells.
23511974 2013 Human microcephaly protein CEP135 binds to hSAS-6 and CPAP, and is required for centriole assembly.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22521416 2012 A truncating mutation of CEP135 causes primary microcephaly and disturbed centrosomal function.
More...