Property Summary

NCBI Gene PubMed Count 28
PubMed Score 16.34
PubTator Score 14.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
MICROCEPHALY 8, PRIMARY, AUTOSOMAL RECESSIVE 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Microcephaly 166 4.473 2.2
Intellectual disability 1016 0.0 4.0

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma 1.100 1.4e-03
Astrocytoma, Pilocytic 1.200 1.0e-05
atypical teratoid / rhabdoid tumor 1.100 7.5e-05
ependymoma 1.300 5.6e-08
glioblastoma 1.600 2.5e-07
group 3 medulloblastoma 2.300 2.1e-05
nasopharyngeal carcinoma 1.300 6.1e-05
non primary Sjogren syndrome sicca -1.200 2.0e-02
osteosarcoma -1.545 1.0e-02
ovarian cancer -1.100 3.1e-04
primitive neuroectodermal tumor 1.300 2.3e-03
psoriasis -2.500 1.1e-05
spina bifida -1.749 3.6e-02
tuberculosis and treatment for 6 months 1.400 3.1e-05
ulcerative colitis 1.300 2.0e-08

Gene RIF (6)

AA Sequence

MTTAVERKYINIRKRLDQLGYRQTLTVECLPLVEKLFSDLVHTTESLRQSKLSAVKAEKESANFDFVLEP      1 - 70
YKLENARLSRENNELYLELMKLREHSDQHVKELKTSLKKCARETADLKFLNNQYAHKLKLLEKESKAKNE     71 - 140
RIQQLQEKNLHAVVQTPGGKKRSIAFRRQRMQIDEPVPPSEVSSYPVPQPDDPYIADLLQVADNRIQELQ    141 - 210
QEVHQLQEKLAMMESGVRDYSKQIELREREIERLSVALDGGRSPDVLSLESRNKTNEKLIAHLNIQVDFL    211 - 280
QQANKDLEKRIRELMETKETVTSEVVNLSNKNEKLCQELTEIDQLAQQLERHKEEVLETADKELGEAKKE    281 - 350
IKRKLSEMQDLEETMAKLQLELNLCQKEKERLSDELLVKSDLETVVHQLEQEKQRLSKKVESFAVTERQL    351 - 420
TLEVERMRLEHGIKRRDRSPSRLDTFLKGIEEERDYYKKELERLQHIIQRRSCSTSYSAREKSSIFRTPE    421 - 490
KGDYNSEIHQITRERDELQRMLERFEKYMEDIQSNVKLLTAERDKLSVLYNEAQEELSALRKESTQTTAP    491 - 560
HNIVSLMEKEKELALSDLRRIMAEKEALREKLEHIEEVSLFGKSELEKTIEHLTCVNHQLESEKYELKSK    561 - 630
VLIMKETIESLENKLKVQAQKFSHVAGDSSHQKTEVNSLRIVNEQLQRSVDDYQHRLSIKRGELESAQAQ    631 - 700
IKILEEKIDELNLKMTSQDEEAHVMKKTIGVIDKEKDFLQETVDEKTEKIANLQENLANKEKAVAQMKIM    701 - 770
ISECESSVNQLKETLVNRDREINSLRRQLDAAHKELDEVGRSREIAFKENRRLQDDLATMARENQEISLE    771 - 840
LEAAVQEKEEMKSRVHKYITEVSRWESLMAAKEKENQDLLDRFQMLHNRAEDWEVKAHQAEGESSSVRLE    841 - 910
LLSIDTERRHLRERVELLEKEIQEHINAHHAYESQISSMAKAMSRLEEELRHQEDEKATVLNDLSSLREL    911 - 980
CIKLDSGKDIMTQQLNSKNLEFERVVVELENVKSESDLLKKQLSNERHTVKNLESLLATNRDKEFHSHLT    981 - 1050
SHEKDTEIQLLKEKLTLSESKLTSQSRENTMLRAKVAQLQTDYDALKRQISTERYERERAIQEMRRHGLA   1051 - 1120
TPPLSSTLRSPSHSPEHRNV                                                     1121 - 1140
//

Text Mined References (31)

PMID Year Title