Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.72
PubTator Score 7.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma 1.300 1.4e-02
Astrocytoma, Pilocytic 1.100 4.9e-05
atypical teratoid / rhabdoid tumor 1.300 1.3e-04
ependymoma 1.400 3.0e-02
glioblastoma 1.100 9.6e-05
group 3 medulloblastoma 1.700 1.6e-04
medulloblastoma, large-cell 1.100 2.0e-02
non primary Sjogren syndrome sicca -1.600 1.8e-02
oligodendroglioma 1.300 3.9e-02
osteosarcoma -1.130 2.1e-03
ovarian cancer -1.200 2.1e-04
pediatric high grade glioma 1.300 2.8e-04
primitive neuroectodermal tumor 1.400 1.2e-03

AA Sequence

MSSKMVISEPGLNWDISPKNGLKTFFSRENYKDHSMAPSLKELRVLSNRRIGENLNASASSVENEPAVSS      1 - 70
ATQAKEKVKTTIGMVLLPKPRVPYPRFSRFSQREQRSYVDLLVKYAKIPANSKAVGINKNDYLQYLDMKK     71 - 140
HVNEEVTEFLKFLQNSAKKCAQDYNMLSDDARLFTEKILRACIEQVKKYSEFYTLHEVTSLMGFFPFRVE    141 - 210
MGLKLEKTLLALGSVKYVKTVFPSMPIKLQLSKDDIATIETSEQTAEAMHYDISKDPNAEKLVSRYHPQI    211 - 280
ALTSQSLFTLLNNHGPTYKEQWEIPVCIQVIPVAGSKPVKVIYINSPLPQKKMTMRERNQIFHEVPLKFM    281 - 350
MSKNTSVPVSAVFMDKPEEFISEMDMSCEVNECRKIESLENLYLDFDDDVTELETFGVTTTKVSKSPSPA    351 - 420
STSTVPNMTDAPTAPKAGTTTVAPSAPDISANSRSLSQILMEQLQKEKQLVTGMDGGPEECKNKDDQGFE    421 - 490
SCEKVSNSDKPLIQDSDLKTSDALQLENSQEIETSNKNDMTIDILHADGERPNVLENLDNSKEKTVGSEA    491 - 560
AKTEDTVLCSSDTDEECLIIDTECKNNSDGKTAVVGSNLSSRPASPNSSSGQASVGNQTNTACSPEESCV    561 - 630
LKKPIKRVYKKFDPVGEILKMQDELLKPISRKVPELPLMNLENSKQPSVSEQLSGPSDSSSWPKSGWPSA    631 - 700
FQKPKGRLPYELQDYVEDTSEYLAPQEGNFVYKLFSLQDLLLLVRCSVQRIETRPRSKKRKKIRRQFPVY    701 - 770
VLPKVEYQACYGVEALTESELCRLWTESLLHSNSSFYVGHIDAFTSKLFLLEEITSEELKEKLSALKISN    771 - 840
LFNILQHILKKLSSLQEGSYLLSHAAEDSSLLIYKASDGKVTRTAYNLYKTHCGLPGVPSSLSVPWVPLD    841 - 910
PSLLLPYHIHHGRIPCTFPPKSLDTTTQQKIGGTRMPTRSHRNPVSMETKSSCLPAQQVETEGVAPHKRK    911 - 980
IT                                                                        981 - 982
//

Text Mined References (20)

PMID Year Title