Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.65
PubTator Score 7.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Cocaine-Related Disorders 88
Paranoia 8
Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 7.32146825532423E-9
primitive neuroectodermal tumor 3031 4.59999753290433E-7
medulloblastoma, large-cell 6234 1.38657584819304E-6
sonic hedgehog group medulloblastoma 1482 1.72191101430753E-6
ovarian cancer 8492 5.41020046632133E-6
osteosarcoma 7933 1.40282674115659E-5
pilocytic astrocytoma 3086 4.36373813457624E-5
glioblastoma 5572 7.57714588757333E-5
pediatric high grade glioma 2712 2.79224472225895E-4
astrocytic glioma 2241 0.014108660064968
non primary Sjogren syndrome sicca 840 0.0177036150523076
ependymoma 2514 0.0296849087592996
oligodendroglioma 2849 0.0391483219744873

Expression

  Differential Expression (13)

Synonym

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG

AA Sequence

MSSKMVISEPGLNWDISPKNGLKTFFSRENYKDHSMAPSLKELRVLSNRRIGENLNASASSVENEPAVSS      1 - 70
ATQAKEKVKTTIGMVLLPKPRVPYPRFSRFSQREQRSYVDLLVKYAKIPANSKAVGINKNDYLQYLDMKK     71 - 140
HVNEEVTEFLKFLQNSAKKCAQDYNMLSDDARLFTEKILRACIEQVKKYSEFYTLHEVTSLMGFFPFRVE    141 - 210
MGLKLEKTLLALGSVKYVKTVFPSMPIKLQLSKDDIATIETSEQTAEAMHYDISKDPNAEKLVSRYHPQI    211 - 280
ALTSQSLFTLLNNHGPTYKEQWEIPVCIQVIPVAGSKPVKVIYINSPLPQKKMTMRERNQIFHEVPLKFM    281 - 350
MSKNTSVPVSAVFMDKPEEFISEMDMSCEVNECRKIESLENLYLDFDDDVTELETFGVTTTKVSKSPSPA    351 - 420
STSTVPNMTDAPTAPKAGTTTVAPSAPDISANSRSLSQILMEQLQKEKQLVTGMDGGPEECKNKDDQGFE    421 - 490
SCEKVSNSDKPLIQDSDLKTSDALQLENSQEIETSNKNDMTIDILHADGERPNVLENLDNSKEKTVGSEA    491 - 560
AKTEDTVLCSSDTDEECLIIDTECKNNSDGKTAVVGSNLSSRPASPNSSSGQASVGNQTNTACSPEESCV    561 - 630
LKKPIKRVYKKFDPVGEILKMQDELLKPISRKVPELPLMNLENSKQPSVSEQLSGPSDSSSWPKSGWPSA    631 - 700
FQKPKGRLPYELQDYVEDTSEYLAPQEGNFVYKLFSLQDLLLLVRCSVQRIETRPRSKKRKKIRRQFPVY    701 - 770
VLPKVEYQACYGVEALTESELCRLWTESLLHSNSSFYVGHIDAFTSKLFLLEEITSEELKEKLSALKISN    771 - 840
LFNILQHILKKLSSLQEGSYLLSHAAEDSSLLIYKASDGKVTRTAYNLYKTHCGLPGVPSSLSVPWVPLD    841 - 910
PSLLLPYHIHHGRIPCTFPPKSLDTTTQQKIGGTRMPTRSHRNPVSMETKSSCLPAQQVETEGVAPHKRK    911 - 980
IT                                                                        981 - 982
//

Text Mined References (16)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23932780 2013 The little elongation complex functions at initiation and elongation phases of snRNA gene transcription.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22195968 2011 The little elongation complex regulates small nuclear RNA transcription.
21269460 2011 Initial characterization of the human central proteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15606750 2004 NARG2 encodes a novel nuclear protein with (S/T)PXX motifs that is expressed during development.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...