Property Summary

NCBI Gene PubMed Count 32
Grant Count 12
R01 Count 8
Funding $930,135.34
PubMed Score 25.09
PubTator Score 17.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (9)

PMID Text
26675350 heterozygous STEAP3 mutations are relatively common in humans and that their deleterious effect in humans remains to be confirmed
22624035 TSAP6 is a target of rhomboid protease RHBDD1-induced proteolysis.
21871451 findings indicate that STEAP3 maintains iron storage in human malignant cells and tumor proliferation under the hypoferric condition
20587610 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19236508 Down-regulated expression of the TSAP6 protein in liver is associated with a transition from cirrhosis to hepatocellular carcinoma
18495927 The crystal structure of the human Steap3 oxidoreductase domain in the absence and presence of NADPH was determined.
15319436 role for TSAP6 in the export of TCTP and indicate that this multipass membrane protein could have a general role in the regulation of vesicular trafficking and secretion.
12606722 TSAP6 may augment Myt1 activity and act downstream to p53 to interface apoptosis and cell-cycle progression

AA Sequence

MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPS      1 - 70
AAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTC     71 - 140
TVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLLP    141 - 210
AWKVPTLLALGLFVCFYAYNFVRDVLQPYVQESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAAL    211 - 280
QLRRGTKYQRFPDWLDHWLQHRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWV    281 - 350
EEEVWRMEIYLSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE    351 - 420
ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHALAEKTSHV      421 - 488
//

Text Mined References (39)

PMID Year Title
26675350 2016 Human STEAP3 mutations with no phenotypic red cell changes.
26205815 2015 Characterization of a single b-type heme, FAD, and metal binding sites in the transmembrane domain of six-transmembrane epithelial antigen of the prostate (STEAP) family proteins.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23958962 2014 Genome-wide association study of cocaine dependence and related traits: FAM53B identified as a risk gene.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22804687 2012 The STEAP protein family: versatile oxidoreductases and targets for cancer immunotherapy with overlapping and distinct cellular functions.
22624035 2012 Exosome-related multi-pass transmembrane protein TSAP6 is a target of rhomboid protease RHBDD1-induced proteolysis.
22522456 2012 STEAP proteins: from structure to applications in cancer therapy.
22420032 2012 Analysis of exosome release and its prognostic value in human colorectal cancer.
22031863 2011 A novel type of congenital hypochromic anemia associated with a nonsense mutation in the STEAP3/TSAP6 gene.
21871451 2011 Human STEAP3 maintains tumor growth under hypoferric condition.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19302216 2009 The regulation of the endosomal compartment by p53 the tumor suppressor gene.
19236508 2009 Down-regulated expression of the TSAP6 protein in liver is associated with a transition from cirrhosis to hepatocellular carcinoma.
19016247 2009 Adenoviral-mediated pHyde gene transfer and cisplatin additively inhibit human prostate cancer growth by enhancing apoptosis.
18495927 2008 Structure of the membrane proximal oxidoreductase domain of human Steap3, the dominant ferrireductase of the erythroid transferrin cycle.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17695374 2007 Steap proteins: implications for iron and copper metabolism.
16651434 2006 The regulation of exosome secretion: a novel function of the p53 protein.
16609065 2006 The Steap proteins are metalloreductases.
16381901 2006 The LIFEdb database in 2006.
16227996 2005 Identification of a ferrireductase required for efficient transferrin-dependent iron uptake in erythroid cells.
15897894 2005 Molecular cloning and characterization of STAMP2, an androgen-regulated six transmembrane protein that is overexpressed in prostate cancer.
15885357 2005 Global gene repression in hepatocellular carcinoma and fetal liver, and suppression of dudulin-2 mRNA as a possible marker for the cirrhosis-to-tumor transition.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15319436 2004 TSAP6 facilitates the secretion of translationally controlled tumor protein/histamine-releasing factor via a nonclassical pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12866033 2003 Human pHyde is not a classical tumor suppressor gene in prostate cancer.
12606722 2003 The p53-inducible TSAP6 gene product regulates apoptosis and the cell cycle and interacts with Nix and the Myt1 kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12095985 2002 Molecular cloning and characterization of STAMP1, a highly prostate-specific six transmembrane protein that is overexpressed in prostate cancer.
11593405 2001 Apoptosis induction in prostate cancer cells by a novel gene product, pHyde, involves caspase-3.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10969787 2000 Growth inhibition of prostate cancer by an adenovirus expressing a novel tumor suppressor gene, pHyde.