Property Summary

NCBI Gene PubMed Count 33
PubMed Score 26.23
PubTator Score 17.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 2.400 4.5e-05
Astrocytoma, Pilocytic 1.800 3.4e-05
cystic fibrosis -1.700 4.2e-03
ependymoma 1.700 1.2e-04
glioblastoma 1.500 2.1e-04
group 3 medulloblastoma 1.500 2.4e-02
lung adenocarcinoma 2.300 8.7e-17
lung carcinoma 1.300 1.5e-16
medulloblastoma, large-cell 1.400 1.8e-02
non primary Sjogren syndrome sicca 1.200 1.1e-02
osteosarcoma -1.093 4.1e-02
pancreatic ductal adenocarcinoma liver m... -1.451 1.7e-02
pituitary cancer 1.300 1.8e-04
tuberculosis 1.100 1.3e-06

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPS      1 - 70
AAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTC     71 - 140
TVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLLP    141 - 210
AWKVPTLLALGLFVCFYAYNFVRDVLQPYVQESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAAL    211 - 280
QLRRGTKYQRFPDWLDHWLQHRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWV    281 - 350
EEEVWRMEIYLSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE    351 - 420
ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHALAEKTSHV      421 - 488
//

Text Mined References (40)

PMID Year Title