Property Summary

NCBI Gene PubMed Count 32
Grant Count 12
R01 Count 8
Funding $930,135.34
PubMed Score 25.09
PubTator Score 17.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Gene RIF (9)

PMID Text
26675350 heterozygous STEAP3 mutations are relatively common in humans and that their deleterious effect in humans remains to be confirmed
22624035 TSAP6 is a target of rhomboid protease RHBDD1-induced proteolysis.
21871451 findings indicate that STEAP3 maintains iron storage in human malignant cells and tumor proliferation under the hypoferric condition
20587610 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19236508 Down-regulated expression of the TSAP6 protein in liver is associated with a transition from cirrhosis to hepatocellular carcinoma
18495927 The crystal structure of the human Steap3 oxidoreductase domain in the absence and presence of NADPH was determined.
15319436 role for TSAP6 in the export of TCTP and indicate that this multipass membrane protein could have a general role in the regulation of vesicular trafficking and secretion.
12606722 TSAP6 may augment Myt1 activity and act downstream to p53 to interface apoptosis and cell-cycle progression

AA Sequence

MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRNPKRTARLFPS      1 - 70
AAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQEHLQHRESNAEYLASLFPTC     71 - 140
TVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSEMALAMGFMPVDMGSLASAWEVEAMPLRLLP    141 - 210
AWKVPTLLALGLFVCFYAYNFVRDVLQPYVQESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAAL    211 - 280
QLRRGTKYQRFPDWLDHWLQHRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWV    281 - 350
EEEVWRMEIYLSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE    351 - 420
ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHALAEKTSHV      421 - 488
//

Text Mined References (39)

PMID Year Title
26675350 2016 Human STEAP3 mutations with no phenotypic red cell changes.
26205815 2015 Characterization of a single b-type heme, FAD, and metal binding sites in the transmembrane domain of six-transmembrane epithelial antigen of the prostate (STEAP) family proteins.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23958962 2014 Genome-wide association study of cocaine dependence and related traits: FAM53B identified as a risk gene.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22804687 2012 The STEAP protein family: versatile oxidoreductases and targets for cancer immunotherapy with overlapping and distinct cellular functions.
22624035 2012 Exosome-related multi-pass transmembrane protein TSAP6 is a target of rhomboid protease RHBDD1-induced proteolysis.
22522456 2012 STEAP proteins: from structure to applications in cancer therapy.
22420032 2012 Analysis of exosome release and its prognostic value in human colorectal cancer.
More...