Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (10)

Disease log2 FC p
aldosterone-producing adenoma 1.216 2.1e-02
Astrocytoma, Pilocytic 2.700 3.1e-10
atypical teratoid / rhabdoid tumor 1.300 3.7e-02
colon cancer -1.500 4.7e-02
glioblastoma 1.300 1.0e-02
lung cancer 1.800 1.2e-02
oligodendroglioma 1.400 2.7e-02
pituitary cancer -1.700 4.0e-05
psoriasis -1.500 1.1e-79
ulcerative colitis -2.600 5.9e-09

Gene RIF (1)

AA Sequence

MAKPFFRLQKFLRRTQFLLFFLTAAYLMTGSLLLLQRVRVALPQGPRAPGPLQTLPVAAVALGVGLLDSR      1 - 70
ALHDPRVSPELLLGVDMLQSPLTRPRPGPRWLRSRNSELRQLRRRWFHHFMSDSQGPPALGPEAARPAIH     71 - 140
SRGTYIGCFSDDGHERTLKGAVFYDLRKMTVSHCQDACAERSYVYAGLEAGAECYCGNRLPAVSVGLEEC    141 - 210
NHECKGEKGSVCGAVDRLSVYRVDELQPGSRKRRTATYRGCFRLPENITHAFPSSLIQANVTVGTCSGFC    211 - 280
SQKEFPLAILRGWECYCAYPTPRFNLRDAMDSSVCGQDPEAQRLAEYCEVYQTPVQDTRCTDRRFLPNKS    281 - 350
KVFVALSSFPGAGNTWARHLIEHATGFYTGSYYFDGTLYNKGFKGEKDHWRSRRTICVKTHESGRREIEM    351 - 420
FDSAILLIRNPYRSLVAEFNRKCAGHLGYAADRNWKSKEWPDFVNSYASWWSSHVLDWLKYGKRLLVVHY    421 - 490
EELRRSLVPTLREMVAFLNVSVSEERLLCVENNKEGSFRRRGRRSHDPEPFTPEMKDLINGYIRTVDQAL    491 - 560
RDHNWTGLPREYVPR                                                           561 - 575
//

Text Mined References (7)

PMID Year Title