Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 1.14672986829872E-79
pilocytic astrocytoma 3086 2.91347752953971E-10
ulcerative colitis 2087 5.85424880488961E-9
pituitary cancer 1972 4.04892841437225E-5
atypical teratoid/rhabdoid tumor 1095 5.15448070861886E-4
glioblastoma 5572 0.0104790247052245
lung cancer 4473 0.0115146149849255
aldosterone-producing adenoma 664 0.0214884976332232
colon cancer 1475 0.0263136670835676
oligodendroglioma 2849 0.0269762330797741

Expression

  Differential Expression (10)

Disease log2 FC p
oligodendroglioma 1.400 0.027
glioblastoma 1.300 0.010
atypical teratoid/rhabdoid tumor 1.600 0.001
colon cancer -1.800 0.026
lung cancer 1.800 0.012
pilocytic astrocytoma 2.700 0.000
aldosterone-producing adenoma 1.216 0.021
ulcerative colitis -2.600 0.000
pituitary cancer -1.700 0.000
psoriasis -1.500 0.000

Synonym

Accession Q658N2 A8K0N8 D3DTM3 O60276 Q96G45
Symbols

Gene

PANTHER Protein Class (2)

  Ortholog (4)

Species Source
Macaque EggNOG Inparanoid
Dog EggNOG Inparanoid
Cow EggNOG Inparanoid
Xenopus EggNOG Inparanoid

Gene RIF (1)

PMID Text
19460752 Knockdown of WSC domain containing 1 (WSCD1) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells

AA Sequence

MAKPFFRLQKFLRRTQFLLFFLTAAYLMTGSLLLLQRVRVALPQGPRAPGPLQTLPVAAVALGVGLLDSR      1 - 70
ALHDPRVSPELLLGVDMLQSPLTRPRPGPRWLRSRNSELRQLRRRWFHHFMSDSQGPPALGPEAARPAIH     71 - 140
SRGTYIGCFSDDGHERTLKGAVFYDLRKMTVSHCQDACAERSYVYAGLEAGAECYCGNRLPAVSVGLEEC    141 - 210
NHECKGEKGSVCGAVDRLSVYRVDELQPGSRKRRTATYRGCFRLPENITHAFPSSLIQANVTVGTCSGFC    211 - 280
SQKEFPLAILRGWECYCAYPTPRFNLRDAMDSSVCGQDPEAQRLAEYCEVYQTPVQDTRCTDRRFLPNKS    281 - 350
KVFVALSSFPGAGNTWARHLIEHATGFYTGSYYFDGTLYNKGFKGEKDHWRSRRTICVKTHESGRREIEM    351 - 420
FDSAILLIRNPYRSLVAEFNRKCAGHLGYAADRNWKSKEWPDFVNSYASWWSSHVLDWLKYGKRLLVVHY    421 - 490
EELRRSLVPTLREMVAFLNVSVSEERLLCVENNKEGSFRRRGRRSHDPEPFTPEMKDLINGYIRTVDQAL    491 - 560
RDHNWTGLPREYVPR                                                           561 - 575
//

Text Mined References (7)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
23740775 2013 Association of granulomatosis with polyangiitis (Wegener's) with HLA-DPB1*04 and SEMA6A gene variants: evidence from genome-wide analysis.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.