Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung adenocarcinoma 2716 1.1e-06
nasopharyngeal carcinoma 1058 2.1e-06
ependymoma 4679 4.6e-02
chronic rhinosinusitis 512 5.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Infertility 188 3.281 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
chronic rhinosinusitis -2.307 5.0e-02
ependymoma 2.000 4.6e-02
lung adenocarcinoma -1.500 1.1e-06
nasopharyngeal carcinoma -2.700 2.1e-06

AA Sequence

MGAKSMRSWCLCQICSCGSDYCPYEIVKQPRHVPEEYKPKQGKIDLGTTYKRDLNSYKVQPVAIVRPLER      1 - 70
QVKKGKLDTVPTYKDDYRAWDLHKSELYKPEQTYHPPTVKFGNSTTFQDDFVPQEIKPRQSFKPSSVVKR     71 - 140
STAPFNGITSHRLDYIPHQLELKFERPKEVYKPTDQRFEDLTTHRCDFQGLIGETAKLCRPVHTRVTQNA    141 - 210
LFEGSTEFRESFQPWEIPPPEVKKVPEYVPPTGSMLLNSTSHLDYVPYQANHVVPIRPVSQKRSNNFPFQ    211 - 280
GKSIMKEDFPAWESCRQGLIKKQQQIPNPSGKFDGLSTFRSHYVPHELIPTESCKPLNIAFKSSVPFDDV    281 - 350
TMYSVEYTPKRQEICPASYPSPPGYIFDNTNSQGHKFFRKIIPAVKAF                          351 - 398
//

Text Mined References (6)

PMID Year Title