Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 1.50390966449025E-8
lung adenocarcinoma 2714 1.13787345933274E-6
nasopharyngeal carcinoma 1056 2.14771006572047E-6
chronic rhinosinusitis 512 0.0496019685628299

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 2.600 0.000
lung adenocarcinoma -1.500 0.000
nasopharyngeal carcinoma -2.700 0.000
chronic rhinosinusitis -2.307 0.050

Synonym

Accession Q658L1 B4E2M2
Symbols FAM154B

Gene

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Cow OMA EggNOG

AA Sequence

MGAKSMRSWCLCQICSCGSDYCPYEIVKQPRHVPEEYKPKQGKIDLGTTYKRDLNSYKVQPVAIVRPLER      1 - 70
QVKKGKLDTVPTYKDDYRAWDLHKSELYKPEQTYHPPTVKFGNSTTFQDDFVPQEIKPRQSFKPSSVVKR     71 - 140
STAPFNGITSHRLDYIPHQLELKFERPKEVYKPTDQRFEDLTTHRCDFQGLIGETAKLCRPVHTRVTQNA    141 - 210
LFEGSTEFRESFQPWEIPPPEVKKVPEYVPPTGSMLLNSTSHLDYVPYQANHVVPIRPVSQKRSNNFPFQ    211 - 280
GKSIMKEDFPAWESCRQGLIKKQQQIPNPSGKFDGLSTFRSHYVPHELIPTESCKPLNIAFKSSVPFDDV    281 - 350
TMYSVEYTPKRQEICPASYPSPPGYIFDNTNSQGHKFFRKIIPAVKAF                          351 - 398
//

Text Mined References (5)

PMID Year Title
25673876 2015 Human FAM154A (SAXO1) is a microtubule-stabilizing protein specific to cilia and related structures.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.