Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 8.6e-89

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.100 8.6e-89

AA Sequence

MATNFLVGEKIWFHKFKYGDAERRFYEQMNGPVAGASLQEASMILHDIARARENIPKSLAGSLGPGASSG      1 - 70
PSGDHSELVVRIASLEVDNQRDLAERAGEELARPLGHSPADPAHVSHAPSGAPGQEASHTSRG            71 - 133
//

Text Mined References (5)

PMID Year Title