Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.80
PubTator Score 6.10

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q643R3 A8K2K8 O43412 Q7Z4P4 Q8IUL7 Q8TB38
Symbols AYTL3
AGPAT7
LPEAT2
LPAAT-eta

Gene

Gene RIF (3)

PMID Text
23815430 LPCAT4 is overexpressed and involved in the deregulation of PC(16:0/16:1) in colorectal cancer.
18458083 LPEAT2 as an important enzyme in the biosynthesis of ethanolamine-containing phospholipids, especially in brain.
16243729 report the cloning and characterization of a novel human 1-acyl-sn-glycerol-3-phosphate acyltransferase member AGPAT7 (1-acyl-sn-glycerol-3-phosphate acyltransferase 7) gene, which was mapped to human chromosome 15q14

AA Sequence

MSQGSPGDWAPLDPTPGPPASPNPFVHELHLSRLQRVKFCLLGALLAPIRVLLAFIVLFLLWPFAWLQVA      1 - 70
GLSEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLQAPVLVAAPHSTFFDPIVLLP     71 - 140
CDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRRVVEEVRRRATSGGKWPQVLFFPEGTCSNKK    141 - 210
ALLKFKPGAFIAGVPVQPVLIRYPNSLDTTSWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYHPSPEESR    211 - 280
DPTLYANNVQRVMAQALGIPATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPG    281 - 350
RSRMISQEEFARQLQLSDPQTVAGAFGYFQQDTKGLVDFRDVALALAALDGGRSLEELTRLAFELFAEEQ    351 - 420
AEGPNRLLYKDGFSTILHLLLGSPHPAATALHAELCQAGSSQGLSLCQFQNFSLHDPLYGKLFSTYLRPP    421 - 490
HTSRGTSQTPNASSPGNPTALANGTVQAPKQKGD                                        491 - 524
//

Text Mined References (12)

PMID Year Title
23815430 2013 Accumulated phosphatidylcholine (16:0/16:1) in human colorectal cancer; possible involvement of LPCAT4.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18458083 2008 Molecular identification of a novel mammalian brain isoform of acyl-CoA:lysophospholipid acyltransferase with prominent ethanolamine lysophospholipid acylating activity, LPEAT2.
16243729 2005 Cloning and characterization a novel human 1-acyl-sn-glycerol-3-phosphate acyltransferase gene AGPAT7.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
More...