Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.80
PubTator Score 6.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 5.61037210258464E-21
oligodendroglioma 2849 9.74615936091282E-19
pilocytic astrocytoma 3086 8.01787747742816E-11
atypical teratoid / rhabdoid tumor 4369 8.20892285821726E-11
group 4 medulloblastoma 1875 1.12262391382539E-8
adult high grade glioma 2148 2.32614397760951E-8
glioblastoma 5572 7.36180484565139E-8
medulloblastoma, large-cell 6234 1.83941390562235E-7
ovarian cancer 8492 1.54989039546248E-5
pancreatic cancer 2300 1.7976681545957E-5
pituitary cancer 1972 3.92824242338765E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 4.30414659825104E-5
Pick disease 1893 3.72687275072515E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 5.15213748797499E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.42635840468391E-4
psoriasis 6685 8.08050883420336E-4
astrocytic glioma 2241 0.00159974977945045
primitive neuroectodermal tumor 3031 0.0018201151182302
subependymal giant cell astrocytoma 2287 0.0099498926903929
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0184504485957757
Disease Target Count Z-score Confidence
Endometriosis of ovary 4 3.802 1.9
Intrahepatic cholestasis 19 3.22 1.6

Expression

Synonym

Accession Q643R3 A8K2K8 O43412 Q7Z4P4 Q8IUL7 Q8TB38
Symbols AYTL3
AGPAT7
LPEAT2
LPAAT-eta

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
23815430 LPCAT4 is overexpressed and involved in the deregulation of PC(16:0/16:1) in colorectal cancer.
18458083 LPEAT2 as an important enzyme in the biosynthesis of ethanolamine-containing phospholipids, especially in brain.
16243729 report the cloning and characterization of a novel human 1-acyl-sn-glycerol-3-phosphate acyltransferase member AGPAT7 (1-acyl-sn-glycerol-3-phosphate acyltransferase 7) gene, which was mapped to human chromosome 15q14

AA Sequence

MSQGSPGDWAPLDPTPGPPASPNPFVHELHLSRLQRVKFCLLGALLAPIRVLLAFIVLFLLWPFAWLQVA      1 - 70
GLSEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLQAPVLVAAPHSTFFDPIVLLP     71 - 140
CDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRRVVEEVRRRATSGGKWPQVLFFPEGTCSNKK    141 - 210
ALLKFKPGAFIAGVPVQPVLIRYPNSLDTTSWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYHPSPEESR    211 - 280
DPTLYANNVQRVMAQALGIPATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSAGYVDAGAEPG    281 - 350
RSRMISQEEFARQLQLSDPQTVAGAFGYFQQDTKGLVDFRDVALALAALDGGRSLEELTRLAFELFAEEQ    351 - 420
AEGPNRLLYKDGFSTILHLLLGSPHPAATALHAELCQAGSSQGLSLCQFQNFSLHDPLYGKLFSTYLRPP    421 - 490
HTSRGTSQTPNASSPGNPTALANGTVQAPKQKGD                                        491 - 524
//

Text Mined References (12)

PMID Year Title
23815430 2013 Accumulated phosphatidylcholine (16:0/16:1) in human colorectal cancer; possible involvement of LPCAT4.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18458083 2008 Molecular identification of a novel mammalian brain isoform of acyl-CoA:lysophospholipid acyltransferase with prominent ethanolamine lysophospholipid acylating activity, LPEAT2.
16243729 2005 Cloning and characterization a novel human 1-acyl-sn-glycerol-3-phosphate acyltransferase gene AGPAT7.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
More...