Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.13
PubTator Score 4.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (9)

Disease log2 FC p
Breast cancer 1.100 1.1e-04
gastric carcinoma 1.300 4.0e-02
medulloblastoma, large-cell -2.000 7.8e-05
osteosarcoma 1.771 7.5e-03
ovarian cancer 3.300 7.0e-08
pancreatic cancer 1.900 6.0e-03
pituitary cancer -2.700 1.2e-06
primary pancreatic ductal adenocarcinoma 1.529 6.7e-03
tuberculosis -1.500 2.1e-03

Synonym

Accession Q641Q3 B3KSJ5 Q86VM0
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (3)

AA Sequence

MRGAARAAWGRAGQPWPRPPAPGPPPPPLPLLLLLLAGLLGGAGAQYSSDRCSWKGSGLTHEAHRKEVEQ      1 - 70
VYLRCAAGAVEWMYPTGALIVNLRPNTFSPARHLTVCIRSFTDSSGANIYLEKTGELRLLVPDGDGRPGR     71 - 140
VQCFGLEQGGLFVEATPQQDIGRRTTGFQYELVRRHRASDLHELSAPCRPCSDTEVLLAVCTSDFAVRGS    141 - 210
IQQVTHEPERQDSAIHLRVSRLYRQKSRVFEPVPEGDGHWQGRVRTLLECGVRPGHGDFLFTGHMHFGEA    211 - 280
RLGCAPRFKDFQRMYRDAQERGLNPCEVGTD                                           281 - 311
//

Text Mined References (9)

PMID Year Title