Property Summary

NCBI Gene PubMed Count 5
PubMed Score 7.02
PubTator Score 4.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 6.9623834592521E-8
pituitary cancer 1972 1.16100149578907E-6
medulloblastoma, large-cell 6234 7.75356551828162E-5
tuberculosis 1563 0.00213587899918949
pancreatic cancer 2300 0.00599813286590305
primary pancreatic ductal adenocarcinoma 1271 0.00673630714108853
osteosarcoma 7933 0.00754119596712807
inflammatory breast cancer 404 0.022212598797071
gastric carcinoma 832 0.0397894437656687
Disease Target Count Z-score Confidence
Actinic keratosis 22 3.067 1.5

Expression

  Differential Expression (9)

Disease log2 FC p
osteosarcoma 1.771 0.008
medulloblastoma, large-cell -2.000 0.000
primary pancreatic ductal adenocarcinoma 1.529 0.007
tuberculosis -1.500 0.002
inflammatory breast cancer 1.100 0.022
gastric carcinoma 1.300 0.040
ovarian cancer 3.300 0.000
pituitary cancer -2.700 0.000
pancreatic cancer 1.900 0.006

Synonym

Accession Q641Q3 B3KSJ5 Q86VM0
Symbols

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (2)

PMID Text
26307585 Data suggest that there is no correlation between serum Metrnl levels and BMI (body mass index) in humans.
24393292 Results show that Subfatin is a novel adipokine regulated by adipogenesis and obesity, with tissue distribution different from its homologue Meteorin

AA Sequence

MRGAARAAWGRAGQPWPRPPAPGPPPPPLPLLLLLLAGLLGGAGAQYSSDRCSWKGSGLTHEAHRKEVEQ      1 - 70
VYLRCAAGAVEWMYPTGALIVNLRPNTFSPARHLTVCIRSFTDSSGANIYLEKTGELRLLVPDGDGRPGR     71 - 140
VQCFGLEQGGLFVEATPQQDIGRRTTGFQYELVRRHRASDLHELSAPCRPCSDTEVLLAVCTSDFAVRGS    141 - 210
IQQVTHEPERQDSAIHLRVSRLYRQKSRVFEPVPEGDGHWQGRVRTLLECGVRPGHGDFLFTGHMHFGEA    211 - 280
RLGCAPRFKDFQRMYRDAQERGLNPCEVGTD                                           281 - 311
//

Text Mined References (8)

PMID Year Title
26307585 2015 Adipocyte Metrnl Antagonizes Insulin Resistance Through PPAR? Signaling.
24906147 2014 Meteorin-like is a hormone that regulates immune-adipose interactions to increase beige fat thermogenesis.
24393292 2014 Subfatin is a novel adipokine and unlike Meteorin in adipose and brain expression.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.